close all open/close all

CDS information : C1027_00280


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction35,289 / 34,453 / - [in whole cluster]
35,289 / 34,453 / - [in contig]
Locationcomplement(34453..35289) [in whole cluster]
complement(34453..35289) [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)haloacetate dehalogenase
GenesgcI
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF22
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [haloacetate dehalogenase]
MSSTREKAAKVESTTVSADGTTIAFDKSGEGPAVILVASALADRSDAKKLAGLLAEHFTV
VNYDRRGRGASADGPAYAVEREIEDIAALIDQVGGSASLFGSSSGAVLALRAAAAGLKVN
KLAVYEPPFSVTSDGFGPPAGFGGQIDSLLAEDRRSDAVKAFMVKAQGMPSFMVGAMRLM
PGVWSNLKGLANTLPYDIAVMGDTQQGKPLPAEPWSAASAPTLVLTGSKSPDGFQRAAKE
LTGVLPDASHRTLNGLNHGAVAMAPKKLAPELIGFLRG
selected fasta
>hypothetical protein [haloacetate dehalogenase]
ATGTCTTCAACCCGTGAGAAAGCAGCCAAGGTGGAATCAACGACGGTATCGGCCGACGGC
ACCACGATCGCCTTCGACAAGTCGGGCGAGGGGCCGGCGGTGATCCTGGTGGCCTCCGCC
TTGGCCGACCGCTCCGACGCCAAGAAGCTCGCCGGTCTCCTCGCCGAGCACTTCACGGTC
GTCAACTACGACCGTCGGGGCCGCGGCGCCAGCGCCGACGGTCCGGCGTACGCGGTCGAG
CGCGAGATCGAGGACATCGCGGCGCTGATCGACCAGGTCGGCGGTTCGGCCTCCCTGTTC
GGCAGCTCTTCCGGCGCGGTGCTCGCCCTGCGAGCCGCCGCCGCCGGCCTGAAGGTGAAC
AAGCTCGCGGTCTACGAGCCGCCGTTCTCCGTCACCTCGGACGGCTTCGGCCCGCCCGCC
GGCTTCGGCGGTCAGATCGACAGCCTTCTGGCGGAGGACCGACGCAGCGACGCGGTCAAG
GCCTTCATGGTCAAGGCACAGGGCATGCCCTCCTTCATGGTCGGCGCCATGCGCCTGATG
CCCGGTGTCTGGTCCAACCTCAAGGGTCTGGCCAACACGCTTCCCTACGACATCGCGGTG
ATGGGCGACACCCAGCAGGGCAAGCCGCTCCCCGCCGAGCCGTGGTCGGCGGCGTCGGCC
CCGACCCTGGTGCTGACCGGTTCCAAGAGCCCCGACGGTTTCCAGCGTGCCGCGAAGGAA
CTCACCGGAGTCCTCCCCGACGCGAGCCACCGCACCCTGAACGGGCTCAACCACGGTGCC
GTCGCCATGGCGCCCAAGAAGCTCGCCCCCGAGCTCATCGGATTCCTGCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit