close all open/close all

CDS information : C1027_00290


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction35,933 / 35,511 / - [in whole cluster]
35,933 / 35,511 / - [in contig]
Locationcomplement(35511..35933) [in whole cluster]
complement(35511..35933) [in contig]
TypeCDS
Length423 bp (140 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenesgcJ
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF18
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[27406907] Crystal structure of SgcJ, an NTF2-like superfamily protein involved in biosynthesis of the nine-membered enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2016)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTSTDSTTSAPDAALAAVAALPARIVAAWADHDADRFADVFAEDGTMILPGLFRKGRENI
RTHMAAAFAGPYKGTRVIGSPIDARLLGDGIALLITEGGILAPGETEASGDGAVRASWLA
VEQDGQWRLAAYQNSPRGND
selected fasta
>hypothetical protein [unknown]
ATGACCAGCACCGACTCGACCACCTCCGCTCCCGACGCCGCCCTGGCAGCGGTAGCCGCT
CTGCCGGCGCGCATCGTGGCCGCCTGGGCCGACCACGACGCCGACCGGTTCGCCGACGTC
TTCGCCGAGGACGGGACGATGATCCTCCCCGGCCTCTTCCGCAAGGGCCGCGAGAACATC
CGCACCCACATGGCGGCCGCCTTCGCGGGCCCGTACAAGGGCACCCGTGTCATCGGCAGC
CCCATCGACGCGCGCCTGCTCGGCGACGGCATCGCCCTGCTCATCACCGAGGGCGGCATC
CTCGCCCCGGGGGAGACCGAGGCGAGCGGCGACGGCGCCGTCCGGGCCTCCTGGCTGGCC
GTCGAACAGGACGGGCAGTGGCGTCTGGCCGCTTACCAGAACAGCCCGCGCGGCAACGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011944 Steroid delta5-4-isomerase (Family)
 [16-138]  5.00000000000001e-46 TIGR02246
TIGR02246   TIGR02246
SignalP No significant hit
TMHMM No significant hit