close all open/close all

CDS information : C1027_00300


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction36,160 / 37,485 / + [in whole cluster]
36,160 / 37,485 / + [in contig]
Location36160..37485 [in whole cluster]
36160..37485 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)citrate/shikimate transporter
GenesgcK
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
P07661
PmId
[2999087] Nucleotide sequence of the gene determining plasmid-mediated citrate utilization. (J Bacteriol. , 1985)
[2999088] Cloning and DNA sequence of a plasmid-determined citrate utilization system in Escherichia coli. (J Bacteriol. , 1985)
ACC
P0AEX3
PmId
[2053984] Escherichia coli kgtP encodes an alpha-ketoglutarate transporter. (Proc Natl Acad Sci U S A. , 1991)
[1554735] Site-directed mutants of Escherichia coli alpha-ketoglutarate permease (KgtP). (Biochemistry. , 1992)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [citrate/shikimate transporter]
MPAVNGSVQSGQSHRRSVVATVVGNFVESFDWLAYGLFAPLFAAQFFPSSNQFTSLLGAF
AVFGTGMLFRPIGGVLLGRLADRRGRRPALMLAIGLMTGGSTLIAVVPTYEHIGILAPLL
LLLARLAQGVSSGGEWTAAATYLMEIAPKNRRCLYSSLFSVTTMAGPFVASLLGAGLGVW
LGTATMEAWGWRVPFLLGGVFGVILLFLRRRLTETEVFRREVRPRARRGSLGQLIGAHRP
QVLLAVMLVAGLGVIGGTWSTAVPAMGHRLIGSQTMFWVVVCVTGSVILLQVPIGLLADR
VEPGRFLIVSSVVFAAVGSYAYLTVQDSFASLAFTYSTGVIFLGCVTMVLPKMLSRIFPP
QIRGLGIGLPHASTTALLGGAGPLLAAYSDERGASGWFIAAVMAAVLLAWPATLWERRLF
RARTAPGSEPVPESAVARPVG
selected fasta
>putative major facilitator superfamily transporter [citrate/shikimate transporter]
ATGCCCGCTGTCAATGGATCGGTGCAGTCAGGCCAGTCGCACCGACGCTCCGTCGTGGCG
ACGGTGGTGGGCAACTTCGTGGAGTCGTTCGACTGGCTCGCCTACGGGCTCTTCGCTCCT
CTCTTCGCGGCTCAGTTCTTCCCCTCGTCCAACCAGTTCACCTCCCTGCTCGGCGCGTTC
GCGGTCTTCGGCACGGGCATGCTCTTCCGGCCGATCGGCGGGGTCCTGCTGGGCCGCCTC
GCCGACCGGCGCGGCCGGCGCCCCGCCCTGATGCTGGCGATCGGACTGATGACCGGCGGC
TCGACCCTGATCGCCGTCGTCCCCACCTACGAGCACATCGGGATCCTCGCCCCGCTGCTT
CTGCTGCTCGCCCGGCTCGCCCAGGGAGTCTCCTCGGGCGGGGAATGGACAGCGGCGGCC
ACCTACCTGATGGAGATCGCGCCGAAGAACCGCCGGTGCCTCTACAGCAGCCTCTTCTCC
GTGACGACCATGGCGGGCCCCTTCGTCGCATCGCTGCTGGGCGCGGGCCTCGGCGTGTGG
CTGGGAACCGCGACGATGGAGGCCTGGGGCTGGCGGGTGCCGTTCCTCCTCGGCGGCGTC
TTCGGCGTGATCCTGCTGTTCCTGCGCCGTCGGCTCACCGAGACCGAGGTCTTCCGCCGG
GAGGTGCGGCCCCGGGCCCGGCGCGGCTCACTGGGCCAGCTGATCGGAGCCCACCGCCCC
CAGGTGCTGCTGGCCGTGATGCTGGTGGCCGGACTGGGCGTCATCGGCGGAACGTGGTCG
ACCGCGGTCCCGGCGATGGGCCACCGTCTGATCGGCTCGCAGACGATGTTCTGGGTGGTG
GTCTGTGTGACCGGCTCGGTCATCCTGCTGCAGGTACCCATAGGGCTGCTCGCCGACCGG
GTGGAACCGGGCAGGTTCCTGATCGTCTCCAGCGTCGTCTTCGCCGCTGTGGGCTCGTAC
GCCTACCTCACCGTCCAGGACTCCTTCGCGAGCCTGGCGTTCACGTACAGCACCGGAGTG
ATCTTCCTCGGCTGCGTCACCATGGTGCTGCCGAAGATGCTCTCCAGAATCTTCCCTCCG
CAGATACGCGGCCTGGGCATCGGGCTGCCGCACGCCTCGACCACCGCACTCCTCGGCGGG
GCGGGGCCACTGCTGGCCGCCTACTCCGACGAGCGAGGCGCCTCGGGCTGGTTCATCGCC
GCCGTGATGGCCGCGGTCCTGCTCGCCTGGCCGGCCACCCTGTGGGAGCGACGGCTGTTC
CGCGCCCGGACGGCCCCGGGAAGCGAGCCGGTTCCCGAATCCGCCGTCGCCCGCCCCGTC
GGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005828 General substrate transporter (Family)
 [19-218]  7.29999999999999e-21 PF00083
PF00083   Sugar_tr
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [9-426]  2.80000504261099e-58 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [17-419]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [22-44]  Transmembrane (i-o) [59-81]  Transmembrane (o-i) [88-110]  Transmembrane (i-o) [114-136]  Transmembrane (o-i) [157-179]  Transmembrane (i-o) [189-208]  Transmembrane (o-i) [243-265]  Transmembrane (i-o) [275-297]  Transmembrane (o-i) [306-325]  Transmembrane (i-o) [329-351]  Transmembrane (o-i) [364-386]  Transmembrane (i-o) [396-415]  Transmembrane (o-i)
Transmembrane 12