close all open/close all

CDS information : C1027_00310


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction37,554 / 38,933 / + [in whole cluster]
37,554 / 38,933 / + [in contig]
Location37554..38933 [in whole cluster]
37554..38933 [in contig]
TypeCDS
Length1,380 bp (459 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase condensation domain protein
Product (GenBank)C-domain type II peptide synthetase
GenesgcC5
Gene (GenBank)
EC number
Keyword
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
  • This ORF catalyzes both ester and amide bond formation between the donor and acceptor substrates.
Note (GenBank)
  • ORF23
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19246381] A free-standing condensation enzyme catalyzing ester bond formation in C-1027 biosynthesis. (Proc Natl Acad Sci U S A. , 2009)
[22519717] Specificity of the ester bond forming condensation enzyme SgcC5 in C-1027 biosynthesis. (Org Lett. , 2012)

close this sectionPKS/NRPS Module

B1
C13..317

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase condensation domain protein [C-domain type II peptide synthetase]
MTTSDTTDRSQDGVPPLSFHQEFLCMFDSGNDGADVGPFGPMYHIVGAWRLTGGIDEETL
REALGDVVVRHEALRTSLVREGGTHRPEILPAGPAALEVRDLGDVDESERVRRGEELLNE
VESTGLSVRELPLLRAVLGRFDQKDAVLVLIAHHTAADAWAMHVIARDLLNLYAARRGNP
VPPLPEPAQHAEFARWEREAAEAPRVAVSKEFWRKRLQGARIIGLETDIPRSAGLPKGTA
WQRFAVRGELADAVVEFSRAAKCSPFMTMFAAYQVLLHRRTGELDITVPTFSGGRNNSRF
EDTVGSFINFLPLRTDLSGCASFREVVLRTRTTCGEAFTHELPFSRLIPEVPELMASAAS
DNHQISVFQAVHAPASEGPEQAGDLTYSKIWERQLSQAEGSDIPDGVLWSIHIDPSGSMA
GSLGYNTNRFKDETMAAFLADYLDVLENAVARPDAPFTS
selected fasta
>non-ribosomal peptide synthetase condensation domain protein [C-domain type II peptide synthetase]
ATGACGACGTCCGACACCACCGACCGGTCCCAGGACGGCGTGCCGCCGCTCTCCTTCCAC
CAGGAGTTCCTGTGCATGTTCGACAGCGGGAACGACGGCGCCGACGTGGGGCCGTTCGGC
CCCATGTACCACATCGTCGGAGCCTGGCGGCTGACCGGCGGGATCGACGAGGAGACCCTG
CGCGAGGCGCTGGGTGACGTCGTCGTGCGCCACGAGGCCCTGCGCACATCGCTGGTCCGC
GAAGGTGGCACGCACCGGCCGGAGATCCTGCCTGCGGGGCCCGCCGCGCTGGAGGTCCGT
GATCTCGGCGACGTCGACGAGTCGGAGCGGGTGCGGCGCGGTGAGGAACTGCTCAACGAG
GTGGAGTCGACCGGTCTGAGCGTGCGGGAGCTGCCCCTGCTGCGGGCCGTGCTCGGACGC
TTCGACCAGAAGGACGCGGTGCTGGTCCTCATCGCCCACCACACCGCCGCGGACGCCTGG
GCCATGCACGTCATCGCCCGCGACCTGCTCAACCTGTACGCCGCCAGGCGCGGGAACCCG
GTTCCCCCGCTCCCCGAGCCGGCCCAGCATGCCGAGTTCGCCCGCTGGGAGCGCGAGGCG
GCCGAGGCACCGCGGGTCGCGGTCTCGAAGGAATTCTGGCGCAAGCGCCTCCAGGGCGCG
CGGATCATCGGGCTGGAGACGGACATACCGCGCTCGGCGGGGCTGCCCAAGGGCACCGCG
TGGCAGCGCTTCGCCGTACGCGGGGAACTGGCCGACGCCGTGGTGGAGTTCTCACGGGCC
GCCAAGTGCTCCCCGTTCATGACCATGTTCGCCGCCTACCAGGTGCTGCTGCACCGCAGG
ACGGGCGAGCTGGACATCACCGTGCCGACCTTCTCCGGGGGGCGCAACAACTCGCGGTTC
GAGGACACCGTCGGTTCCTTCATCAACTTCCTGCCGCTGCGTACCGACCTCTCCGGATGC
GCATCCTTCCGCGAGGTCGTGCTGCGCACCCGCACCACCTGCGGAGAGGCGTTCACCCAC
GAGCTGCCCTTCTCCCGGCTGATCCCGGAGGTGCCGGAGCTGATGGCGTCGGCGGCCTCC
GACAACCACCAGATCTCCGTCTTCCAGGCCGTGCACGCGCCCGCGTCCGAGGGGCCCGAG
CAGGCCGGGGACCTGACGTACTCGAAGATCTGGGAGCGGCAGCTGTCGCAGGCGGAGGGC
TCCGACATCCCCGACGGGGTGCTGTGGTCGATCCACATCGACCCCTCGGGCTCCATGGCC
GGCAGCCTCGGGTACAACACCAACCGCTTCAAGGACGAGACGATGGCGGCCTTCCTGGCC
GACTACCTCGACGTGCTCGAGAACGCGGTGGCCCGGCCGGACGCCCCCTTCACCTCCTGA
[1] C13..317
[1] C37..951

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [13-317]  2.1e-44 PF00668
PF00668   Condensation
SignalP No significant hit
TMHMM No significant hit