close all open/close all

CDS information : C1027_00320


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction38,978 / 39,259 / + [in whole cluster]
38,978 / 39,259 / + [in contig]
Location38978..39259 [in whole cluster]
38978..39259 [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase peptidyl carrier protein
Product (GenBank)type II PCP
GenesgcC2
Gene (GenBank)
EC number
Keyword
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF26
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)

close this sectionPKS/NRPS Module

B1
PCP13..79

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase peptidyl carrier protein [type II PCP]
MSTVSDTAAGSSLEEKVTRIWTGVLGTSGEEGATFIELGGQSVSAVRIATRIQEELDIWV
DIGVLFDDPDLPTFIAAVVRTADAAGGEGSGTQ
selected fasta
>non-ribosomal peptide synthetase peptidyl carrier protein [type II PCP]
GTGTCCACCGTTTCCGACACAGCGGCCGGCTCCTCCCTGGAGGAGAAGGTCACCCGGATC
TGGACGGGTGTTCTCGGCACGTCCGGTGAGGAAGGCGCGACGTTCATCGAGCTCGGAGGG
CAGTCGGTCTCGGCCGTGCGCATCGCCACGCGTATCCAGGAGGAGCTCGACATCTGGGTC
GACATCGGCGTCCTCTTCGACGACCCGGATCTGCCTACCTTCATCGCGGCGGTCGTCCGG
ACGGCCGACGCCGCGGGCGGCGAGGGCTCCGGAACGCAGTGA
[1] PCP13..79
[1] PCP37..237

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [5-79]  1.6e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [11-83]  6.899999633797e-10 SSF47336
SSF47336   ACP_like
 [13-79]  PS50075
PS50075   ACP_DOMAIN
 [15-77]  7.80000000000001e-08 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit