close all open/close all

CDS information : C1027_00330


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction40,981 / 39,362 / - [in whole cluster]
40,981 / 39,362 / - [in contig]
Locationcomplement(39362..40981) [in whole cluster]
complement(39362..40981) [in contig]
TypeCDS
Length1,620 bp (539 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase
Product (GenBank)putative ammonia lyase/transferase
GenesgcC4
Gene (GenBank)
EC number
Keyword
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF24
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12785829] A novel 4-methylideneimidazole-5-one-containing tyrosine aminomutase in enediyne antitumor antibiotic C-1027 biosynthesis. (J Am Chem Soc. , 2003)
[14580219] Kinetic analysis of the 4-methylideneimidazole-5-one-containing tyrosine aminomutase in enediyne antitumor antibiotic C-1027 biosynthesis. (Biochemistry. , 2003)
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[17516659] The structure of L-tyrosine 2,3-aminomutase from the C-1027 enediyne antitumor antibiotic biosynthetic pathway. (Biochemistry. , 2007)
[18078753] Design and characterization of mechanism-based inhibitors for the tyrosine aminomutase SgTAM. (Bioorg Med Chem Lett. , 2008)
[20577998] Probing the active site of MIO-dependent aminomutases, key catalysts in the biosynthesis of beta-amino acids incorporated in secondary metabolites. (Biopolymers. , 2010)

close this sectionSequence

selected fasta
>4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase [putative ammonia lyase/transferase]
MALTQVETEIVPVSVDGETLTVEAVRRVAEERATVDVPAESIAKAQKSREIFEGIAEQNI
PIYGVTTGYGEMIYMQVDKSKEVELQTNLVRSHSAGVGPLFAEDEARAIVAARLNTLAKG
HSAVRPIILERLAQYLNEGITPAIPEIGSLGASGDLAPLSHVASTLIGEGYVLRDGRPVE
TAQVLAERGIEPLELRFKEGLALINGTSGMTGLGSLVVGRALEQAQQAEIVTALLIEAVR
GSTSPFLAEGHDIARPHEGQIDTAANMRALMRGSGLTVEHADLRRELQKDKEAGKDVQRS
EIYLQKAYSLRAIPQVVGAVRDTLYHARHKLRIELNSANDNPLFFEGKEIFHGANFHGQP
IAFAMDFVTIALTQLGVLAERQINRVLNRHLSYGLPEFLVSGDPGLHSGFAGAQYPATAL
VAENRTIGPASTQSVPSNGDNQDVVSMGLISARNARRVLSNNNKILAVEYLAAAQAVDIS
GRFDGLSPAAKATYEAVRRLVPTLGVDRYMADDIELVADALSRGEFLRAIARETDIQLR
selected fasta
>4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase [putative ammonia lyase/transferase]
ATGGCATTGACTCAAGTCGAGACCGAGATCGTCCCGGTTTCCGTCGACGGCGAGACCCTG
ACCGTCGAAGCCGTACGCCGCGTCGCGGAGGAACGCGCGACGGTCGACGTACCGGCCGAA
TCCATCGCGAAGGCCCAGAAGAGCCGGGAGATCTTCGAAGGGATCGCCGAACAGAACATC
CCCATCTACGGGGTGACCACCGGGTACGGCGAGATGATCTACATGCAGGTCGACAAGTCG
AAGGAAGTCGAACTGCAGACCAATCTCGTCCGTAGCCACAGCGCGGGAGTCGGTCCGCTG
TTCGCCGAGGACGAGGCGCGGGCGATCGTCGCCGCCCGGCTGAACACCCTCGCCAAGGGC
CACTCCGCGGTGCGCCCCATCATCCTCGAACGCCTCGCGCAGTACCTGAACGAGGGCATC
ACCCCGGCCATACCCGAGATCGGGTCACTCGGGGCGAGCGGCGACCTGGCTCCCCTCTCC
CACGTCGCGAGCACCCTCATCGGAGAGGGCTACGTCCTGCGCGACGGACGGCCGGTGGAG
ACCGCCCAGGTGCTGGCCGAGCGGGGCATCGAGCCGCTCGAACTGCGCTTCAAGGAGGGC
CTCGCACTGATCAACGGCACGTCCGGGATGACCGGTCTGGGCTCCCTGGTCGTCGGACGG
GCCCTGGAGCAGGCCCAGCAGGCCGAGATCGTGACGGCTCTGCTCATCGAGGCGGTACGC
GGATCGACCAGCCCCTTCCTCGCGGAGGGGCACGACATAGCCCGCCCGCACGAGGGCCAG
ATCGACACCGCCGCCAACATGCGGGCCCTGATGCGGGGCAGCGGACTGACGGTCGAGCAC
GCCGACCTGCGCCGAGAACTCCAGAAGGACAAGGAGGCCGGCAAGGACGTCCAGCGCTCG
GAGATCTACCTGCAGAAGGCCTACTCGCTGCGGGCCATCCCCCAGGTCGTCGGGGCGGTG
CGCGACACCTTGTACCACGCGCGGCACAAGCTGCGCATCGAGCTCAACTCGGCCAACGAC
AACCCGCTCTTCTTCGAGGGCAAGGAGATCTTCCACGGGGCGAACTTCCACGGTCAGCCG
ATCGCGTTCGCGATGGACTTCGTGACCATCGCGCTCACCCAGCTCGGCGTCCTGGCCGAG
CGGCAGATCAACCGGGTCCTGAACCGGCACCTCAGCTACGGCCTCCCGGAGTTCCTCGTC
TCCGGGGACCCGGGGCTGCACAGCGGATTCGCCGGCGCCCAGTACCCGGCCACCGCACTG
GTGGCCGAGAACCGGACGATCGGCCCGGCCAGCACCCAGAGCGTCCCGTCCAACGGCGAC
AACCAGGACGTGGTGAGCATGGGCCTGATCTCGGCCCGCAACGCCCGCCGGGTCCTGTCG
AACAACAACAAGATCCTCGCGGTGGAGTACCTGGCCGCCGCCCAGGCGGTCGACATCTCC
GGCCGGTTCGACGGCTTGAGCCCGGCGGCGAAGGCCACGTACGAAGCGGTGCGCCGGCTG
GTTCCGACGCTGGGCGTCGACCGGTACATGGCCGACGACATCGAGCTGGTCGCCGACGCG
CTGTCCCGCGGCGAGTTCCTCCGGGCGATCGCCCGGGAGACGGACATCCAGCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001106 Aromatic amino acid lyase (Family)
 [13-504]  PF00221
PF00221   Lyase_aromatic
IPR008948 L-Aspartase-like (Domain)
 [12-530]  SSF48557
SSF48557   L-Aspartase-like
IPR022313 Phenylalanine/histidine ammonia-lyases, active site (Active_site)
 [148-164]  PS00488
PS00488   PAL_HISTIDASE
IPR022314 Tyrosine 2,3-aminomutase, putative (Family)
 [15-521]  TIGR03832
TIGR03832   Tyr_2_3_mutase
IPR024083 L-Aspartase-like, N-terminal (Domain)
 [12-206]  1.79999999999997e-69 G3DSA:1.10.275.10
G3DSA:1.10.275.10   G3DSA:1.10.275.10
SignalP No significant hit
TMHMM No significant hit