close all open/close all

CDS information : C1027_00340


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction43,692 / 41,047 / - [in whole cluster]
43,692 / 41,047 / - [in contig]
Locationcomplement(41047..43692) [in whole cluster]
complement(41047..43692) [in contig]
TypeCDS
Length2,646 bp (881 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase adenylation domain protein
Product (GenBank)A-domain type II peptide synthetase
GenesgcC1
Gene (GenBank)
EC number
Keyword
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF25
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[16887797] Substrate specificity of the adenylation enzyme SgcC1 involved in the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Biol Chem. , 2006)

close this sectionPKS/NRPS Module

B1 L-alpha-tyrosine
A396..808

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [A-domain type II peptide synthetase]
MRRRPKMGVVANDVTVTEPDRGPSPASGSAVLHPYAAYHVSGGLDLEALRTAWRAAAGDG
AAVDGPSADEECGEEELCARWAARPFAEGDAPARLHIARRGPRAHLLLLVASHSGAWDGP
SGPLPAALSNAYLAVTTGGRPPTAPAPQTPRAPGSEESSATASGQVLPADRNRPHLPSHA
GSTVAFGWSPDLGFRTARLAEAEGVTAAAVVLAGFRALVQRYAGQDDGTPATAFRELLHT
TPAPAPGPCRIEGADAVFVHEERPGLRIPGAEVRRLSVHNGTAAADLTLVLQDTAPSVTG
YLEYREALFEPASARRMLDQLAVLLTAATTDPDTPVGALPLDDDRHRDHALRASDRRASG
GDMTRPVHASVRRHAEHDGVAVSFGGTRTSYAELTAELTADAARVASALTAAGAGHGSPV
AVRMQPGARRIAVLLGVLEAGAHLAWFAPDGAGERHRSMLSDLRPACLVLDGDPQEDPLA
LWYAGEPGATLLDASSVLGPRPAAGPDATTAAGPGLADLAYVAFTSGSTGRPKGIAQSHA
ALGQFAGWMGERFAMGPGARVAQWVSPEHDPALAEVFATLVAGGTLCPVPERVRVNPDKL
VPWLVQERITHLQTVPSFARDLLGVITASDPGDRPGTLGHLLLMGEALPGELVDGLRAAL
PRTRLINLYGPTETIAATWHEITGPVTGPAPIGYPLPGRQVLVVDADDRPSPAGVTGELV
IRSPYVTPGYLAVEGGPDHSALFAPLAGLAPDGDRWYRTGDLARVRFDGALEFRGRKDFQ
VKLFGNRLELTEIEAALNRDPSVLECAVLPHVNGQGLVTRLAVYVVPQGEGREDVRADIR
AWRSHLRGQFGPLALPAVFTRLTSRLPRNAAGKVDRSRLTR
selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [A-domain type II peptide synthetase]
GTGCGCCGCCGCCCCAAGATGGGCGTCGTGGCGAATGACGTGACTGTGACCGAGCCGGAC
CGGGGGCCTTCGCCGGCCTCCGGATCTGCGGTGTTGCACCCGTACGCGGCCTACCACGTG
AGCGGCGGACTCGACCTGGAGGCCCTGCGGACGGCCTGGCGGGCCGCCGCCGGAGACGGG
GCCGCCGTGGACGGGCCGAGTGCCGACGAGGAGTGCGGGGAGGAGGAACTCTGCGCTCGC
TGGGCGGCCCGTCCCTTCGCCGAGGGTGACGCGCCCGCACGGCTCCACATCGCCCGCAGA
GGCCCACGCGCGCACCTGCTTCTCCTGGTGGCCTCGCACTCCGGAGCCTGGGACGGGCCG
TCCGGGCCCCTGCCGGCCGCGTTGTCGAACGCGTACCTCGCCGTCACCACCGGCGGCCGG
CCTCCCACTGCGCCCGCGCCGCAAACGCCCCGGGCGCCCGGGAGCGAGGAGTCTTCGGCG
ACCGCCTCCGGACAGGTCCTGCCCGCCGACCGGAACCGCCCGCACCTGCCCTCGCACGCG
GGGAGCACCGTCGCCTTCGGCTGGAGTCCGGACCTCGGCTTCCGTACGGCCCGGCTCGCC
GAAGCGGAAGGGGTCACCGCCGCGGCCGTGGTGCTGGCCGGATTCCGAGCCCTGGTCCAG
CGCTACGCCGGACAGGACGACGGCACGCCGGCCACCGCCTTCCGGGAGCTGCTGCACACG
ACGCCGGCCCCGGCCCCCGGGCCGTGCCGGATCGAGGGGGCCGACGCCGTGTTCGTCCAC
GAGGAGCGGCCGGGCCTGCGGATACCAGGCGCCGAGGTGAGGCGGCTGTCCGTGCACAAC
GGCACTGCCGCCGCCGACCTGACCCTGGTGCTGCAGGACACCGCGCCCTCGGTCACCGGC
TACCTGGAGTACCGCGAAGCTCTGTTCGAGCCCGCTTCGGCCCGGCGGATGCTGGATCAG
CTGGCCGTCCTCCTGACCGCCGCGACCACGGATCCGGACACACCCGTGGGCGCTCTGCCG
CTGGACGACGACCGCCACCGGGACCACGCCCTGCGCGCTTCGGACCGCCGGGCGTCCGGC
GGGGACATGACGCGGCCGGTGCACGCCTCGGTCCGCCGCCACGCGGAACACGACGGTGTC
GCCGTCTCGTTCGGCGGCACGCGCACAAGCTACGCCGAACTGACCGCCGAACTGACCGCG
GACGCGGCCCGCGTCGCCTCGGCCCTCACCGCGGCCGGCGCGGGGCACGGCTCGCCGGTG
GCGGTGCGGATGCAGCCGGGCGCCCGCCGGATCGCGGTGCTGCTGGGAGTCCTGGAGGCG
GGCGCCCACCTGGCGTGGTTCGCTCCGGACGGCGCGGGCGAACGACACCGGTCGATGCTC
AGCGATCTGCGCCCGGCGTGCCTGGTCCTCGACGGCGATCCGCAGGAGGATCCGCTGGCG
CTCTGGTACGCCGGTGAACCGGGCGCCACCCTGCTGGACGCCTCCTCTGTGCTCGGCCCT
CGACCCGCCGCCGGCCCGGACGCGACGACCGCGGCGGGGCCGGGCCTGGCAGACCTGGCC
TACGTGGCGTTCACCTCGGGTTCGACCGGGCGGCCCAAGGGGATCGCCCAGTCGCATGCC
GCGCTGGGCCAGTTCGCGGGCTGGATGGGCGAACGGTTCGCGATGGGGCCGGGCGCGCGG
GTGGCGCAGTGGGTCTCCCCGGAGCACGACCCGGCGCTGGCCGAGGTCTTCGCGACGCTC
GTGGCCGGCGGGACGCTGTGTCCGGTGCCGGAGCGCGTCAGGGTGAACCCCGACAAGCTG
GTGCCGTGGCTCGTCCAGGAGCGGATCACTCATCTCCAGACCGTGCCCAGCTTCGCCCGG
GACCTCCTGGGAGTGATCACCGCCTCCGACCCGGGCGATCGGCCCGGCACCCTGGGCCAC
CTGCTCCTGATGGGCGAGGCGCTGCCCGGCGAACTCGTGGACGGACTGCGCGCGGCCCTG
CCCCGGACCCGCCTGATCAACCTCTACGGGCCCACCGAGACGATCGCCGCGACCTGGCAC
GAGATCACCGGGCCGGTCACGGGCCCGGCCCCGATCGGGTACCCGCTCCCCGGCCGCCAG
GTACTCGTCGTGGACGCGGACGACCGGCCGAGCCCCGCCGGCGTCACCGGCGAACTGGTG
ATCCGCTCCCCGTACGTGACGCCGGGTTATCTCGCCGTCGAGGGCGGCCCGGACCACAGC
GCGCTGTTCGCGCCCCTCGCCGGCCTCGCCCCGGACGGTGACCGGTGGTACCGGACCGGG
GATCTGGCGCGGGTACGGTTCGACGGAGCCCTGGAATTCCGGGGCCGCAAGGACTTCCAG
GTCAAGCTGTTCGGGAACCGCTTGGAACTCACCGAGATCGAGGCCGCGCTGAACCGTGAC
CCCTCGGTCCTGGAGTGCGCGGTCCTCCCCCACGTCAACGGCCAGGGCCTGGTGACCCGC
CTCGCCGTGTACGTGGTGCCACAAGGAGAGGGCCGGGAGGACGTGCGCGCGGACATCCGG
GCCTGGCGTTCCCATCTGCGCGGCCAGTTCGGCCCCCTCGCACTGCCCGCCGTCTTCACC
CGCCTGACTTCACGCCTGCCGCGCAACGCCGCGGGGAAGGTGGACCGCTCCCGGCTCACC
CGCTGA
[1] A396..808
[1] L-alpha-tyrosine570..676
[1] A1186..2424
[1] L-alpha-tyrosine1708..2028

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [396-808]  2.50000000000001e-80 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [165-227]  4.6e-05 PF00668
PF00668   Condensation
IPR020845 AMP-binding, conserved site (Conserved_site)
 [522-533]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit