close all open/close all

CDS information : C1027_00350


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction43,940 / 46,018 / + [in whole cluster]
43,940 / 46,018 / + [in contig]
Location43940..46018 [in whole cluster]
43940..46018 [in contig]
TypeCDS
Length2,079 bp (692 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)antibiotic transporter
GenesgcB4
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF27
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q53902
NITE
Actino_00150
PmId
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>hypothetical protein [antibiotic transporter]
MPGDRRGKWLVLAAWLIIAMALGPLAGKLADVQDSSANAFLPRSSESAKLNKELEKFRAD
ELMPAVVVYSADGSLPAEGRAKAEKDIAAFQELAAEGEKVEAPLESEDGQALMVVVPLIS
DADIVATTKKVRDVADANAPPGVAIEVGGPAGSTTDAAGAFESLDSMLMMVTGLVVAILL
LITYRSPILWLLPLLSVGFASVLTQVGTYMLAKYAGLPVDPQSSGVLMVLVFGVGTDYAL
LLIARYREELRREQDRHVAMKTALRRSGPAILASAGTIAIGLVCLVLADVNSSRSMGLVG
AIGVVCALLAMVTILPALLVILGRWVFWPFVPRWTPESAAAPEAPASHSRWERIGSVTAA
RPRRAWVLSLAATGLLALSSLGLDMGLTQSELLQTKPESVVAQERISAHYPSGSSDPATV
VAPSADVAEVRRAAEGTDGVVSVQDGPTTPDGELTMLSVVLKDVPDSSGAKDTIDALRDN
TDALVGGTTAQSLDTQRASVRDLWVTVPAVLLVVLLVLIWLLRSVTGPLIMLGTVVVSFF
AALGASNLLFEYVMGHAGVDWSVPLLGFVYLVALGIDYNIFLMHRVKEEVALHGHAKGVL
TGLTTTGGVITSAGVVLAATFAVIATLPLVPMAQMGVVVGLGILLDTFLVRTILLPALAL
DLGPRFWWPGALSKTSGGPAPVREDRTSQPVG
selected fasta
>hypothetical protein [antibiotic transporter]
GTGCCCGGTGACAGACGTGGAAAGTGGCTGGTCCTGGCCGCCTGGCTCATCATCGCGATG
GCGCTGGGCCCGCTGGCGGGGAAGCTCGCCGACGTCCAGGACTCCAGCGCCAACGCCTTC
CTTCCGCGCAGCTCGGAGTCCGCGAAGCTGAACAAGGAACTGGAGAAGTTCCGCGCCGAC
GAGCTGATGCCGGCCGTGGTGGTCTACAGCGCCGACGGCTCGCTGCCCGCCGAGGGGCGG
GCCAAGGCCGAGAAGGACATAGCCGCCTTCCAGGAGCTGGCCGCCGAGGGCGAGAAGGTC
GAAGCGCCCCTGGAGTCGGAGGACGGCCAGGCGCTCATGGTCGTCGTTCCGCTGATCAGC
GACGCCGACATCGTCGCCACGACGAAGAAGGTCCGCGATGTCGCGGACGCCAACGCCCCC
CCGGGCGTCGCCATCGAGGTGGGCGGGCCCGCCGGGTCGACGACCGACGCCGCCGGCGCT
TTCGAGTCCCTCGACTCCATGCTGATGATGGTCACCGGCCTTGTGGTCGCCATCCTGCTG
CTGATCACCTACCGCTCCCCCATCCTGTGGCTGCTGCCCCTGCTCTCCGTCGGCTTCGCC
TCCGTGCTGACCCAGGTCGGCACCTACATGCTCGCCAAGTACGCCGGGCTGCCGGTCGAC
CCGCAGAGCTCCGGCGTCCTGATGGTCCTCGTGTTCGGTGTCGGCACCGACTACGCCCTG
CTGCTCATCGCCCGCTACCGTGAGGAACTGCGCCGCGAGCAGGACCGGCACGTGGCCATG
AAGACCGCGTTGCGACGGTCGGGCCCGGCCATCCTGGCCTCGGCCGGCACCATCGCCATC
GGCCTCGTCTGCCTGGTCCTCGCGGACGTCAACTCCTCCCGCTCCATGGGCCTGGTCGGC
GCGATCGGCGTGGTCTGCGCCCTCCTCGCCATGGTCACGATCCTGCCCGCGCTGCTGGTC
ATCCTGGGCCGCTGGGTGTTCTGGCCCTTCGTTCCCCGCTGGACGCCGGAGTCGGCCGCG
GCCCCCGAGGCACCGGCGTCCCACAGCCGCTGGGAGCGCATCGGCTCCGTCACGGCCGCC
CGGCCGCGCCGCGCCTGGGTGCTGTCCTTGGCCGCGACGGGGCTTCTCGCCCTCAGTTCC
CTCGGCCTCGACATGGGACTCACCCAGAGCGAACTGCTCCAGACGAAGCCCGAGTCCGTC
GTCGCCCAGGAGCGGATCTCCGCCCACTACCCGTCCGGCTCCTCCGACCCCGCCACCGTC
GTCGCACCCAGCGCGGACGTGGCCGAGGTCCGCCGGGCCGCCGAGGGGACCGACGGAGTG
GTCTCCGTCCAGGACGGCCCCACCACTCCCGACGGAGAGCTGACCATGCTGTCCGTGGTG
CTGAAGGACGTTCCCGACAGCAGCGGGGCCAAGGACACCATCGATGCACTGCGGGACAAC
ACGGATGCTCTCGTGGGGGGTACGACGGCCCAGAGCCTGGACACCCAGCGCGCCTCGGTC
CGTGACCTCTGGGTCACCGTCCCCGCGGTCCTGCTGGTGGTCCTGCTCGTCCTGATCTGG
CTGCTGCGCTCGGTCACCGGACCGCTGATCATGCTCGGCACCGTGGTCGTGTCGTTCTTC
GCGGCCCTGGGGGCGTCCAACCTGCTCTTCGAGTACGTGATGGGGCACGCCGGCGTCGAC
TGGTCGGTGCCGCTTCTCGGGTTCGTGTACCTGGTCGCCCTCGGAATCGACTACAACATC
TTCCTCATGCACCGGGTGAAGGAGGAGGTCGCTCTGCACGGCCATGCCAAGGGCGTGCTC
ACCGGCCTGACCACCACCGGGGGCGTCATCACCAGTGCCGGCGTGGTCCTGGCCGCGACG
TTCGCCGTCATCGCCACACTGCCGCTGGTCCCGATGGCCCAGATGGGTGTCGTGGTCGGC
CTGGGCATTCTGCTGGACACCTTCCTCGTCCGGACGATTCTTCTGCCGGCCCTGGCGCTC
GATCTGGGGCCCCGGTTCTGGTGGCCGGGCGCGCTGTCGAAGACGTCCGGGGGACCGGCC
CCCGTCCGCGAGGACCGCACGTCCCAGCCCGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000731 Sterol-sensing domain (Domain)
 [199-321]  PS50156
PS50156   SSD
IPR004869 Membrane transport protein, MMPL type (Domain)
 [78-363]  7.40000000000006e-65 PF03176 [427-676]  8.89999999999994e-45 PF03176
PF03176   MMPL
SignalP
 [1-27]  0.764 Signal
Eukaryota   
TMHMM
 [7-26]  Transmembrane (i-o) [166-183]  Transmembrane (o-i) [188-210]  Transmembrane (i-o) [225-247]  Transmembrane (o-i) [268-290]  Transmembrane (i-o) [300-322]  Transmembrane (o-i) [503-522]  Transmembrane (i-o) [527-549]  Transmembrane (o-i) [561-583]  Transmembrane (i-o) [603-625]  Transmembrane (o-i) [638-660]  Transmembrane (i-o)
Transmembrane 11