close all open/close all

CDS information : C1027_00360


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction46,162 / 47,166 / + [in whole cluster]
46,162 / 47,166 / + [in contig]
Location46162..47166 [in whole cluster]
46162..47166 [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
GenesgcD4
Gene (GenBank)
EC number2.1.1.-
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF28
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)
Related Reference
ACC
Q84HC8
NITE
Ncarz_00050
PmId
[18387946] Regiospecific O-methylation of naphthoic acids catalyzed by NcsB1, an O-methyltransferase involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (J Biol Chem. , 2008)
[19702337] Molecular basis of substrate promiscuity for the SAM-dependent O-methyltransferase NcsB1, involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (Biochemistry. , 2009)
[20735485] In vivo characterization of NcsB3 to establish the complete biosynthesis of the naphthoic acid moiety of the neocarzinostatin chromophore. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MLGDEDGKAAELWSMANLGTPMAVRVAATLRIADHITAGAHTAGEIAEAAAVHEESLDRL
LRYLTVRGLLDRDGLGRYTLTPLGRPLCEDHPAGVRAWFDMEGAGRGELSFVDLLHSVRT
GKAAFPLRYGRPFWEDLAEDPRRAESFNRLLGQDVATRAPAVVAGFDWASTGHVIDLGGG
DGSLLTALLTACPSLRGTVLDLPEAVQRAKESFAVSGLDDRANAVAGSFFDALPAGAGAY
VLSLVLHDWDDEASVAILRRCAEAAGQTGSVFVIESTGSAGDAPHTGMDLRMLCIYGAKE
RRVEEFEELAGRAGLRVVAVHPAGPSAIIQMSAV
selected fasta
>putative O-methyltransferase [O-methyltransferase]
GTGTTGGGCGATGAGGACGGCAAGGCCGCCGAGCTGTGGTCGATGGCGAACCTGGGTACA
CCGATGGCCGTGCGCGTCGCGGCGACCCTGCGCATCGCCGACCACATCACGGCCGGAGCG
CACACCGCCGGCGAAATCGCCGAAGCGGCCGCCGTGCACGAGGAATCCCTCGACCGGCTG
CTGCGCTACCTCACCGTCCGGGGCCTGCTGGACCGTGACGGGCTCGGCCGGTACACGCTG
ACCCCCCTGGGCCGGCCGCTGTGCGAGGACCACCCCGCCGGCGTCCGGGCCTGGTTCGAC
ATGGAGGGAGCGGGGCGGGGCGAGCTGTCGTTCGTCGACCTGCTGCACAGCGTACGGACC
GGGAAGGCCGCCTTCCCCCTGCGCTACGGCCGCCCCTTCTGGGAGGACCTGGCGGAGGAC
CCCCGCCGCGCGGAGTCCTTCAACCGGCTGCTCGGCCAGGACGTCGCCACTCGCGCCCCG
GCCGTGGTGGCCGGCTTCGACTGGGCGAGCACCGGTCATGTCATCGACCTCGGAGGCGGC
GACGGCTCCCTGCTGACCGCACTGCTGACCGCCTGTCCGTCACTGCGCGGCACGGTCCTG
GACCTGCCCGAAGCGGTGCAGCGTGCCAAGGAGTCGTTCGCCGTGTCCGGACTGGACGAC
CGGGCGAACGCGGTCGCGGGCAGCTTCTTCGACGCCCTCCCCGCCGGCGCGGGCGCCTAC
GTCCTGTCCCTGGTCCTGCACGACTGGGACGACGAGGCGTCCGTCGCGATCCTGCGGCGC
TGCGCCGAGGCGGCGGGGCAGACGGGATCGGTGTTCGTCATCGAGTCGACCGGCTCGGCG
GGGGACGCCCCGCACACAGGTATGGACCTGCGCATGCTGTGCATCTACGGAGCCAAGGAG
CGCCGCGTGGAGGAGTTCGAGGAACTCGCCGGCCGGGCCGGGCTCCGGGTCGTCGCCGTC
CACCCCGCGGGCCCTTCCGCGATCATCCAGATGTCCGCGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [74-310]  1.6e-50 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [20-84]  2.1e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-332]  2.00000075217456e-12 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit