close all open/close all

CDS information : C1027_00370


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction47,223 / 48,479 / + [in whole cluster]
47,223 / 48,479 / + [in contig]
Location47223..48479 [in whole cluster]
47223..48479 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450 hydroxylase
GenesgcD3
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF29
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)
Related Reference
ACC
O87605
NITE
Pikro_00170
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[9778370] Characterization of the macrolide P-450 hydroxylase from Streptomyces venezuelae which converts narbomycin to picromycin. (Biochemistry. , 1998)
[9831532] Hydroxylation of macrolactones YC-17 and narbomycin is mediated by the pikC-encoded cytochrome P450 in Streptomyces venezuelae. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 hydroxylase]
MAGLVMSPVEALDALGTVQGRQDPYPFYEAIRAHGQAVPTKPGRFVVVGHDACDRALREP
ALRVQDARSYDVVFPSWRSHSSVRGFTSSMLYSNPPDHGRLRQVVSFAFTPPKVRRMHGV
IEDMTDRLLDRMARLGSGGSPVDLIAEFAARLPVAVISEMIGFPAKDQVWFRDMASRVAV
ATDGFTDPGALTGADAAMDEMSAYFDDLLDRRRRTPADDLVTLLAEAHDGSPGRLDHDEL
MGTMMVLLTAGFETTSFLIGHGAMIALEQRAHAARLRAEPDFADGYVEEILRFEPPVHVT
SRWAAEDLDLLGLSVPAGSKLVLILAAANRDPGRYPEPGRFDPDRYAPRPGGPEATRPLS
FGAGGHFCLGAPLARLEARIALPRLLRRFPDLAVSEPPVYRDRWVVRGLETFPVTLGS
selected fasta
>putative cytochrome P450 [P450 hydroxylase]
ATGGCCGGCCTGGTCATGTCGCCGGTGGAGGCGCTCGACGCGCTGGGCACGGTGCAGGGG
CGTCAGGACCCCTATCCCTTCTACGAGGCGATCCGCGCGCACGGGCAGGCGGTCCCCACG
AAGCCCGGCCGCTTCGTGGTGGTCGGCCACGACGCGTGCGACCGGGCGCTGCGGGAACCG
GCCCTGCGCGTCCAGGACGCCAGGAGCTACGACGTCGTCTTCCCCTCGTGGCGGTCGCAC
TCCTCGGTCCGGGGGTTCACCAGCTCCATGCTCTACAGCAACCCGCCCGATCACGGCCGG
TTGCGCCAGGTGGTGAGCTTCGCGTTCACCCCGCCCAAGGTGCGCCGGATGCACGGGGTG
ATCGAGGACATGACCGACCGGCTCCTCGACCGGATGGCCCGGCTCGGCTCCGGCGGCTCC
CCGGTCGACCTCATAGCCGAGTTCGCCGCCCGGCTGCCCGTCGCGGTGATCAGCGAGATG
ATCGGCTTTCCGGCGAAGGACCAGGTGTGGTTCCGCGACATGGCCTCCCGGGTCGCCGTG
GCGACGGACGGTTTCACCGACCCCGGCGCGCTCACGGGGGCCGACGCCGCCATGGACGAG
ATGAGCGCCTACTTCGACGACCTCCTGGACCGTCGCCGCCGCACCCCGGCCGACGACCTG
GTCACCCTGCTCGCCGAGGCCCACGACGGCTCCCCCGGGCGCCTGGACCACGACGAACTG
ATGGGCACCATGATGGTGCTGCTCACAGCCGGGTTCGAGACCACGAGCTTTCTGATCGGC
CACGGGGCGATGATCGCCCTCGAACAACGGGCGCACGCGGCCCGGCTGCGGGCCGAACCC
GACTTCGCCGACGGCTACGTCGAGGAGATCCTCAGGTTCGAGCCGCCGGTCCACGTCACC
AGCCGGTGGGCTGCCGAGGACCTCGACCTGCTGGGCCTGTCCGTACCGGCGGGCTCCAAG
CTGGTCCTGATCCTGGCCGCCGCGAATCGCGATCCCGGCCGCTACCCCGAGCCCGGCCGC
TTCGACCCCGACCGCTACGCGCCCCGGCCGGGCGGGCCGGAGGCCACCAGACCGCTGAGC
TTCGGCGCGGGCGGCCACTTCTGCCTCGGCGCTCCGCTGGCGCGGCTGGAAGCCCGGATC
GCGCTGCCGCGTCTGCTGCGCCGCTTCCCGGACCTGGCCGTGTCCGAGCCCCCCGTCTAC
CGCGACCGCTGGGTCGTCCGCGGCCTCGAAACCTTTCCCGTGACCCTCGGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [250-267]  1.10000029896148e-05 PR00385 [285-296]  1.10000029896148e-05 PR00385 [359-368]  1.10000029896148e-05 PR00385 [368-379]  1.10000029896148e-05 PR00385
PR00385   P450
 [19-416]  1.79999999999997e-99 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [198-389]  2.7e-26 PF00067
PF00067   p450
 [22-416]  4.60000044330866e-88 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [93-104]  1.60000240695997e-49 PR00359 [143-159]  1.60000240695997e-49 PR00359 [160-175]  1.60000240695997e-49 PR00359 [203-225]  1.60000240695997e-49 PR00359 [285-296]  1.60000240695997e-49 PR00359 [302-329]  1.60000240695997e-49 PR00359 [330-345]  1.60000240695997e-49 PR00359 [359-368]  1.60000240695997e-49 PR00359 [368-379]  1.60000240695997e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [361-370]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit