close all open/close all

CDS information : C1027_00380


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction49,709 / 48,603 / - [in whole cluster]
49,709 / 48,603 / - [in contig]
Locationcomplement(48603..49709) [in whole cluster]
complement(48603..49709) [in contig]
TypeCDS
Length1,107 bp (368 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
GenesgcL
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF30
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q6PV90
PmId
[15357313] Molecular cloning and identification of a novel oxygenase gene specifically induced during the growth of Rhodococcus sp. strain T104 on limonene. (J Microbiol. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MDQTSTPARTELVERASKLRPLLQSHAAWTEENRRLHEESVEAMAEAGIFRMRVPARYGG
FESDARTLVDVAAELARGDGSAAWTASVWWIPTWMAGLFPDHVQDEVFSRPDVRVSGTLS
PGGMAAPVDGGVVVNGKWGFISGAWHSHWQVLIAVSPTPDGGMQPVMALVPTDQLQIVDD
WHTSGLRGSGSVSTIAADVFVPQERVLPLGAVLQQQYASELNAGSPMFRAPMLAVASASS
VGTMTGLAAAAQDVFRGRLPGRKITYTEYEEQGSAPITHLQLGEATLLADEARFHAHRLA
DLVDSKGASGEAWTLEERVLCRGLLGRACRLGKESVDILAQASGGSSIYNDVPIQRVQRC
PEHHAAPA
selected fasta
>putative oxidoreductase [oxidoreductase]
GTGGACCAGACGTCTACGCCCGCCCGTACCGAACTGGTGGAACGGGCCTCGAAGCTGAGG
CCGCTGCTCCAGTCCCACGCGGCCTGGACCGAGGAGAACCGGCGGCTGCACGAGGAGTCG
GTCGAGGCGATGGCCGAAGCCGGGATCTTCCGCATGCGCGTGCCGGCCCGTTACGGCGGC
TTCGAGTCCGACGCCCGCACCCTGGTGGACGTGGCCGCCGAGCTGGCGCGCGGCGACGGA
TCGGCCGCCTGGACGGCCTCGGTGTGGTGGATACCCACCTGGATGGCGGGCCTCTTCCCC
GACCACGTGCAGGACGAGGTGTTCTCCCGGCCGGATGTCCGGGTCTCCGGCACCCTCAGT
CCCGGCGGCATGGCGGCCCCGGTCGACGGCGGTGTCGTAGTGAACGGCAAGTGGGGCTTC
ATCAGCGGTGCCTGGCACAGTCACTGGCAGGTTCTGATCGCCGTCTCACCGACCCCCGAC
GGCGGCATGCAGCCCGTGATGGCCCTGGTGCCGACCGACCAGCTGCAGATCGTCGACGAC
TGGCACACCTCGGGGCTCCGGGGCTCGGGAAGCGTCAGCACCATCGCCGCGGACGTCTTC
GTTCCCCAGGAGCGCGTCCTTCCGCTGGGCGCGGTGCTCCAGCAGCAGTACGCCTCCGAA
CTCAACGCCGGATCACCGATGTTCCGGGCGCCGATGCTGGCCGTGGCCTCGGCCTCGTCG
GTCGGCACCATGACCGGACTGGCCGCGGCCGCTCAGGACGTCTTCCGCGGGAGGCTGCCC
GGCCGCAAGATCACCTACACCGAGTACGAGGAGCAGGGCTCGGCGCCGATCACCCACCTG
CAGCTCGGCGAGGCGACCCTGCTGGCCGACGAGGCACGGTTCCACGCCCATCGGCTGGCC
GACCTCGTCGACTCCAAGGGGGCTTCGGGCGAGGCCTGGACGCTGGAGGAGCGGGTGCTG
TGCCGCGGCCTGCTGGGGCGGGCGTGCCGACTGGGCAAGGAGTCGGTGGACATCCTCGCC
CAGGCGAGCGGCGGGTCCTCGATCTACAACGACGTCCCGATCCAGCGCGTGCAGCGATGC
CCAGAGCATCACGCTGCACCTGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [115-201]  1e-26 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [24-87]  2.3e-08 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [202-359]  2.6e-26 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-209]  5.8999880940569e-38 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [242-359]  5.90000000000001e-17 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [2-111]  4.6e-36 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit