close all open/close all

CDS information : C1027_00390


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction50,345 / 51,385 / + [in whole cluster]
50,345 / 51,385 / + [in contig]
Location50345..51385 [in whole cluster]
50345..51385 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
GenesgcM
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF31
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MRPLVRAVLRGSLRQVRYVDVVSPRRARSLVARVYRETEEQFGVLAPPLALHSPAAASLA
ATWLMLRETLLVDGRVSRAVKETVATEVSRANDCPYCVQVHQAVLGTLPPDGGQAGLLRW
VREAGRRPGGGAVGGGRPLPFSGEQAPELCGVVVTFHYINRMVSLFLDDSPMPTRTPTPL
RGPIMRTTALAMRPVGPGLLTPGASLGLLPPAPLPPGLEWAEGNPFVAQALGRAVAAVDQ
GAHWVPEPVRERLRTRLDTWDGSAPGLGRGWLDEAVSGLPPQDVPAARLALLTAFAPYQV
LPDDVEEFRRRRPTDRELVELTSYAALTTAVRVGRTLVVPDAAGPG
selected fasta
>hypothetical protein [unknown]
ATGAGGCCGCTCGTTCGGGCAGTGCTGCGGGGTTCCCTGCGGCAGGTGAGGTACGTGGAC
GTGGTCTCCCCGCGCCGGGCGCGCTCCCTGGTGGCGCGGGTGTACCGGGAGACCGAGGAG
CAGTTCGGCGTGCTCGCGCCCCCCCTGGCCCTCCACTCGCCCGCCGCGGCGTCGCTGGCC
GCGACGTGGCTCATGCTGCGGGAGACACTGCTGGTCGACGGGCGGGTGAGCCGGGCGGTG
AAGGAGACGGTCGCCACCGAGGTCTCCCGTGCCAACGACTGTCCGTACTGCGTCCAGGTC
CATCAGGCGGTACTCGGGACACTGCCTCCGGACGGCGGCCAGGCCGGGCTCCTGCGGTGG
GTCCGGGAGGCAGGCCGACGGCCCGGCGGCGGTGCGGTGGGCGGCGGGCGGCCGCTTCCG
TTCAGCGGTGAACAGGCACCGGAACTGTGCGGCGTCGTGGTCACGTTCCACTACATCAAC
CGCATGGTCTCCCTCTTCCTCGACGACTCCCCCATGCCGACCCGGACGCCGACACCGTTG
CGCGGGCCCATCATGAGGACCACCGCACTGGCCATGCGTCCCGTCGGCCCGGGGCTGCTG
ACACCGGGCGCATCGCTCGGCCTGCTGCCTCCGGCTCCCCTGCCGCCCGGACTGGAGTGG
GCCGAGGGCAACCCTTTCGTGGCCCAGGCGCTGGGGCGTGCCGTCGCCGCTGTGGACCAG
GGAGCGCACTGGGTGCCCGAACCGGTCCGGGAGCGGCTGCGCACACGTCTGGACACCTGG
GACGGATCGGCGCCGGGCCTCGGCCGGGGATGGCTCGACGAGGCCGTGTCCGGCCTGCCG
CCCCAGGACGTGCCCGCGGCACGGCTGGCGCTGCTGACGGCCTTCGCCCCCTACCAGGTG
CTCCCGGACGACGTCGAGGAGTTCAGACGGCGTCGGCCCACCGACCGCGAACTCGTCGAG
CTCACGTCCTACGCCGCGCTGACCACGGCCGTCCGTGTCGGTCGCACGCTCGTCGTGCCC
GACGCCGCCGGGCCGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [59-101]  7.90000000000001e-07 PF02627
PF02627   CMD
SignalP No significant hit
TMHMM No significant hit