close all open/close all

CDS information : C1027_00400


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction52,336 / 51,416 / - [in whole cluster]
52,336 / 51,416 / - [in contig]
Locationcomplement(51416..52336) [in whole cluster]
complement(51416..52336) [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
GenesgcN
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF32
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q96NR8
PmId
[12226107] Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina. (J Biol Chem. , 2002)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MRTRRRWSAADVPDRTGTTAVVTGASSGIGLHLAQELARHGAHVVLAVRDPDRGVAAAAR
IQSRVPSAQLTVRRLDLSRLASVRAGAEELRDRFPRIHLLVNNAGVMWTDRARTPDGHEL
QFATNHLGHFALTGLLLDSLRAAPGARVVTISSYLHRLGRIDFSDLHGERRYSRYRAYNQ
SKLANLMFALELHHRLAESGAELASLAAHPGLTATGLGRDFPAPVRRLGSPLAPLFLQPA
AAGMLPGLRAATDPGARGGEFYGPLGVTETRGAPGLVRPGGAAVDPRARRRLWEESEHLT
GVRLRP
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGAGAACGCGGCGACGCTGGAGCGCCGCCGATGTCCCGGACCGTACCGGAACCACCGCG
GTGGTCACCGGTGCCAGCTCCGGCATCGGACTGCACCTGGCGCAGGAGCTCGCCCGGCAC
GGCGCCCACGTGGTGCTGGCCGTGCGCGATCCGGACCGCGGGGTCGCCGCGGCGGCCCGC
ATCCAAAGCCGGGTGCCGTCGGCGCAACTGACGGTCAGACGGCTGGATCTTTCCCGTCTC
GCGTCGGTGCGTGCCGGCGCCGAGGAACTGCGCGACCGCTTCCCGCGCATCCACCTGCTG
GTCAACAACGCGGGCGTGATGTGGACCGACCGGGCCCGCACCCCGGACGGTCACGAACTC
CAGTTCGCCACGAACCACCTGGGGCACTTCGCCCTCACCGGCCTGCTCCTGGACAGCCTG
CGGGCCGCGCCGGGCGCGCGGGTCGTGACGATCAGCAGCTATCTGCACCGGCTGGGGCGC
ATCGACTTCAGCGACCTTCACGGCGAACGCCGCTACAGCCGGTACCGGGCCTACAACCAG
TCCAAGCTGGCCAACCTCATGTTCGCGCTGGAACTCCATCACAGACTGGCGGAGTCCGGC
GCGGAACTGGCCTCGCTCGCCGCTCATCCCGGGCTGACCGCGACCGGTCTGGGCCGGGAC
TTTCCCGCGCCCGTGCGCAGGCTCGGCTCCCCGCTCGCCCCGTTGTTCCTGCAGCCCGCC
GCGGCGGGGATGCTGCCTGGTCTGCGGGCGGCCACCGATCCCGGCGCGCGCGGGGGCGAG
TTCTACGGGCCCCTCGGCGTGACCGAGACCCGGGGCGCACCCGGGCTCGTGCGCCCCGGC
GGAGCAGCCGTCGACCCCAGGGCCCGGCGCCGCCTCTGGGAGGAGTCCGAGCACCTCACC
GGCGTACGCCTCCGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [19-160]  6.3e-21 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [19-36]  5.69999708783953e-10 PR00081 [95-106]  5.69999708783953e-10 PR00081 [140-156]  5.69999708783953e-10 PR00081 [178-197]  5.69999708783953e-10 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [16-239]  1e-59 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit