close all open/close all

CDS information : C1027_00405


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction52,912 / 52,361 / - [in whole cluster]
52,912 / 52,361 / - [in contig]
Locationcomplement(52361..52912) [in whole cluster]
complement(52361..52912) [in contig]
TypeCDS
Length552 bp (183 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GenesgcO
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein
MPHIALDNDLPGISGLMAHHPGTAAPLGDLANALLRAPSSLEPGQRELIAAYVSHLNSTE
FCAASHGAFAAAQLPGGRQLVEAVLADPATAPIDGRTRALLAVAAEVQSAARPVSAGVIA
SARAEGADDTALHDTVLIAAAFCMFNRYVSGLATELPKDDEYYEHSARQIVANGYRAAMA
QAG
selected fasta
>hypothetical protein
GTGCCCCACATAGCACTCGACAACGACCTCCCCGGCATCAGTGGTCTGATGGCTCACCAC
CCCGGCACCGCAGCACCGCTGGGCGATCTCGCGAACGCCCTGCTGCGGGCGCCGTCCTCG
CTGGAACCGGGGCAACGCGAGCTCATCGCGGCGTACGTCTCGCATCTCAACTCCACCGAG
TTCTGCGCCGCCTCCCACGGGGCCTTCGCCGCCGCGCAGCTGCCGGGAGGCCGGCAGCTC
GTCGAGGCCGTCCTCGCCGACCCCGCCACCGCGCCCATCGACGGCAGGACGCGCGCGCTG
CTGGCCGTCGCCGCCGAGGTCCAGAGCGCGGCGCGCCCGGTCTCCGCAGGGGTGATCGCC
TCGGCGCGGGCCGAGGGAGCGGACGACACCGCTCTGCACGACACCGTTCTGATCGCCGCC
GCGTTCTGCATGTTCAACCGGTACGTCAGCGGTCTCGCCACGGAGCTGCCGAAGGACGAC
GAGTACTACGAGCACTCCGCCCGGCAGATCGTCGCCAACGGCTACCGGGCCGCGATGGCC
CAGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [23-71]  1.4e-06 PF02627
PF02627   CMD
SignalP No significant hit
TMHMM No significant hit