close all open/close all

CDS information : C1027_00415


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction53,879 / 53,241 / - [in whole cluster]
53,879 / 53,241 / - [in contig]
Locationcomplement(53241..53879) [in whole cluster]
complement(53241..53879) [in contig]
TypeCDS
Length639 bp (212 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl carrier protein
Product (GenBank)
GenesgcP
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein
MPLEVAKVTSDRSAVSGRNRSAGSGAPKGPDGDEHRLGDVGEFMVGAWSELLGRSDLTEH
SDFFARGGDTLLITRLVRRITERFGVTVSLRELSRRNLGDQVALVHASRLRSARRGSRRT
VVTTGDIRQVLVRGWGDLLGFPDPSEGADFFAHGGDSLLITRLVRRINRELGVTLPVRDM
LAAPTLGEQTLLLCDAVAGSRRSVFTSGRQSG
selected fasta
>putative acyl carrier protein
ATGCCCCTGGAGGTGGCGAAAGTGACCAGTGACCGCTCTGCCGTCTCCGGCCGGAACCGT
TCCGCGGGATCCGGCGCGCCGAAGGGCCCCGACGGCGACGAGCACCGGCTCGGTGACGTG
GGGGAGTTCATGGTCGGCGCGTGGAGCGAGCTCCTCGGCCGCTCCGACCTCACCGAGCAT
TCGGATTTCTTCGCGCGCGGCGGGGACACGCTGCTGATCACGCGGCTGGTCCGCAGGATC
ACCGAGAGGTTCGGCGTCACGGTGTCGCTGCGCGAGCTGTCGCGGCGCAACCTCGGCGAC
CAGGTGGCGCTGGTGCATGCCTCGCGGCTGCGCTCGGCACGTCGGGGCTCCCGGCGCACG
GTCGTCACCACCGGCGACATCCGCCAGGTACTGGTGCGCGGCTGGGGTGACCTGCTCGGC
TTCCCGGACCCCTCCGAAGGTGCTGATTTCTTCGCCCACGGCGGCGACTCCCTGCTCATC
ACCCGGCTGGTCCGCAGGATCAACCGCGAGCTGGGCGTCACGCTCCCGGTACGCGACATG
CTGGCCGCCCCGACGCTGGGTGAGCAGACCCTGCTGCTCTGCGACGCGGTCGCGGGATCT
CGCCGTTCCGTCTTTACCAGCGGCCGACAGTCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [36-95]  2.6e-11 G3DSA:1.10.1200.10 [124-193]  3.3e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [46-94]  3.9e-08 PF00550 [130-188]  4e-12 PF00550
PF00550   PP-binding
 [36-108]  4.1e-10 SSF47336 [120-195]  1.7e-14 SSF47336
SSF47336   ACP-like
 [40-107]  12.018 PS50075 [123-194]  15.485 PS50075
PS50075   ACP_DOMAIN
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [41-97]  0.19 SM00823 [128-197]  3.1e-05 SM00823
SM00823   Phosphopantetheine attachment site
SignalP No significant hit
TMHMM No significant hit