close all open/close all

CDS information : C1027_00420


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction54,226 / 55,374 / + [in whole cluster]
54,226 / 55,374 / + [in contig]
Location54226..55374 [in whole cluster]
54226..55374 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional repressor
Product (GenBank)unknown
GenesgcR
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF34
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)

close this sectionSequence

selected fasta
>transcriptional repressor [unknown]
MSTGYLSRLESGARQPSDRAVAHLAGQLGISPSEFEGSRATSLAQILSLSTSLESDETSE
LLAEAVRSAHGQDPMLRWQALWLLGQWKRRHGDSAGEHGYLQRLVTLSEEIGLAELRARA
LTQFARSLRVLGEIVPAVEAAAAAHRLAVDHALSSQDRAASLLVLVSVEAEAGRMPDARR
HADELTVLVRGRSDTLWAEALWTAGALKVRQGEFAAAEVLFQEALDGFDSRENLTIWLRL
RIAMAELHLQKLPPEPDAAQLCIEAAEAALPFARTSALEQSLAALRARLAFHEGRFADAR
ALLERLGRTELRLPYQSRIRLEVLGHQLRILSGEEEEGLAGLQLLAEEAQENSNINLAAE
IWRLAAECLMRARGKVRGATGG
selected fasta
>transcriptional repressor [unknown]
ATGTCTACGGGCTATCTCTCGCGCCTGGAGTCGGGCGCCCGGCAGCCCTCCGATCGCGCC
GTCGCCCACCTGGCCGGACAACTCGGCATCAGCCCGTCGGAGTTCGAAGGGTCCCGGGCC
ACCTCGCTCGCCCAGATCCTCTCCCTCTCCACTTCCCTGGAGTCCGACGAGACCAGTGAG
CTTCTCGCCGAGGCGGTACGTTCCGCGCATGGCCAGGATCCGATGCTCCGCTGGCAGGCC
CTGTGGCTGCTGGGACAGTGGAAGCGCCGGCACGGCGACTCGGCCGGCGAGCACGGCTAC
CTCCAGCGTCTGGTGACGCTGAGTGAGGAGATCGGCCTGGCCGAGTTGCGCGCACGGGCC
CTGACCCAGTTCGCCCGGTCGCTGCGGGTACTGGGCGAGATCGTTCCGGCGGTGGAGGCT
GCCGCCGCCGCCCACCGGCTCGCGGTGGACCATGCGCTGTCCAGCCAGGACAGGGCCGCT
TCGCTGCTGGTTCTGGTGTCGGTGGAGGCCGAGGCGGGACGGATGCCCGACGCCCGGCGC
CACGCCGACGAACTGACCGTCCTGGTGAGGGGACGGTCCGACACTCTGTGGGCCGAGGCG
TTGTGGACGGCGGGTGCGTTGAAGGTGCGGCAGGGCGAGTTCGCCGCGGCCGAGGTCCTT
TTCCAGGAGGCTCTGGACGGGTTCGACAGCCGGGAGAACCTGACGATCTGGCTGCGGCTG
CGCATCGCGATGGCCGAACTCCACCTGCAGAAACTTCCTCCCGAGCCCGACGCCGCGCAG
CTCTGCATCGAGGCGGCGGAGGCGGCCCTTCCCTTTGCCCGCACATCCGCTCTGGAACAG
TCCCTCGCCGCTCTGCGGGCGCGCCTCGCCTTCCATGAGGGCAGGTTCGCCGATGCCCGC
GCGTTGTTGGAGAGGCTCGGCAGGACCGAGCTCCGGCTGCCCTATCAGAGCCGGATCCGC
CTGGAGGTCCTCGGTCATCAGCTGCGCATCCTGAGCGGGGAGGAGGAGGAAGGCCTGGCC
GGCCTCCAGCTCCTGGCCGAGGAGGCGCAGGAGAACTCCAACATCAACCTCGCCGCGGAG
ATCTGGCGGCTCGCGGCGGAATGCCTGATGCGGGCGCGCGGGAAGGTCCGCGGCGCCACC
GGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [1-38]  0.00041 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
IPR011990 Tetratricopeptide-like helical (Domain)
 [54-351]  8.60000000000001e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit