close all open/close all

CDS information : C1027_00430


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction56,021 / 56,875 / + [in whole cluster]
56,021 / 56,875 / + [in contig]
Location56021..56875 [in whole cluster]
56021..56875 [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductases
Product (GenBank)putative oxidase
GenesgcQ
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF35
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Family/Domain
FD
IPR008219

close this sectionSequence

selected fasta
>putative oxidoreductases [putative oxidase]
MFSPAARRYVLASDRAGFFEQAVRLRSRGYRVSAEFVGPDQGATDALHAEHVVEEHLRLL
DQEPAPDRIGVDVSRIGLAHSAQTALRNTGRLAAAAALRGSEVVLLMEGSEDIDTVLAVH
DALVNRYDNVGITLQAHLHRTVDDAMAVAGPGRTVRLVMGSSAEPAGTALSRGPALEDRY
LDLAELLVDRGVRLSLATPDAEVLAGAQERGLLERVQDIEMLYGVRPELLRRHRAAGRPC
RIHAAYGMNWWLPLLRRLADNPPMVLNALADIGRDREPVAHQAY
selected fasta
>putative oxidoreductases [putative oxidase]
ATGTTCTCCCCCGCCGCCCGCCGGTACGTGCTCGCCTCGGACCGCGCGGGGTTCTTCGAG
CAGGCTGTCCGGCTGCGCTCCCGGGGGTACCGGGTGAGCGCGGAGTTCGTCGGCCCCGAT
CAGGGAGCCACCGACGCCCTCCACGCGGAGCACGTGGTCGAAGAGCACCTGAGGCTGCTC
GATCAGGAGCCGGCCCCTGACCGGATCGGTGTGGACGTCTCCCGGATCGGCCTCGCCCAC
TCGGCGCAGACTGCCCTGCGCAACACCGGGCGGCTGGCTGCCGCTGCGGCGCTCCGCGGG
AGCGAGGTCGTCCTGCTCATGGAGGGGTCCGAGGACATCGACACCGTGCTGGCCGTCCAT
GACGCCCTGGTGAACCGTTACGACAACGTGGGGATCACCCTTCAGGCGCACCTGCACCGC
ACCGTGGACGACGCCATGGCGGTCGCGGGTCCTGGCCGCACCGTGCGGCTGGTCATGGGC
TCCTCGGCCGAGCCTGCCGGCACCGCTCTGTCCCGGGGCCCCGCTCTGGAGGACCGGTAC
CTTGACCTCGCGGAGCTTCTCGTGGACCGTGGCGTCCGGCTGAGTCTGGCCACTCCGGAC
GCCGAGGTCCTGGCCGGGGCGCAGGAGCGTGGTCTGCTCGAACGCGTCCAGGACATCGAG
ATGCTCTACGGTGTGCGGCCCGAGCTGCTGCGCCGCCACCGGGCGGCGGGCCGCCCCTGT
CGCATCCACGCGGCCTACGGGATGAACTGGTGGCTTCCCCTGCTGCGGAGGCTGGCCGAC
AACCCGCCGATGGTGCTCAACGCCCTGGCCGACATCGGCCGGGACCGGGAGCCCGTCGCC
CACCAGGCGTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008219 Proline dehydrogenase, predicted (Family)
 [1-277]  5.6999970878395e-108 PIRSF000196
PIRSF000196   Pro_dehydrog
SignalP No significant hit
TMHMM No significant hit