close all open/close all

CDS information : C1027_00440


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction57,725 / 56,922 / - [in whole cluster]
57,725 / 56,922 / - [in contig]
Locationcomplement(56922..57725) [in whole cluster]
complement(56922..57725) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
GenesgcE11
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF36
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MNSLDDVLKHLATDIEELAQLVEKIDDEAWNTPTPAPGWTVTDQIAHLTFVFNLARTAAA
APEEFKAVTAAAAGNFDGAVNAALQQFKGFPPQELLTRFRGMGRASVEALAAVPAGQVVP
WLVNPLPPVVLGCAGIMEVFAHGQDVADALGVRRTPTERLRNIVDFAWLTRDFGYESHGL
TPPAAPFRFELTAPSGEVWTVGPEDATETVSGPAHDFCLLVTRRRHRDDLALTASGQEAE
KWLDIAQAYRGPAGEGRRPGQFAATGS
selected fasta
>hypothetical protein [unknown]
ATGAATTCGCTCGACGACGTCCTCAAGCACCTGGCCACCGACATCGAGGAGCTGGCGCAG
CTGGTCGAGAAGATCGACGACGAAGCCTGGAACACTCCGACGCCGGCGCCCGGCTGGACC
GTCACCGACCAGATCGCCCACCTCACCTTCGTCTTCAACCTGGCCAGGACCGCGGCGGCG
GCGCCGGAGGAGTTCAAGGCCGTCACGGCCGCCGCGGCAGGCAACTTCGACGGAGCGGTC
AACGCGGCTCTGCAGCAGTTCAAGGGCTTCCCGCCGCAGGAACTGCTCACCCGCTTCCGG
GGCATGGGGCGGGCCTCGGTCGAGGCGCTCGCCGCGGTCCCCGCCGGCCAGGTGGTTCCG
TGGCTGGTCAACCCGCTGCCGCCGGTCGTTCTGGGCTGCGCCGGGATCATGGAGGTGTTC
GCCCACGGCCAGGACGTCGCCGACGCCCTGGGTGTCCGGCGCACGCCCACCGAGCGGCTT
CGCAACATCGTCGACTTCGCCTGGCTGACACGCGACTTCGGCTACGAGTCCCACGGTCTG
ACCCCGCCGGCCGCGCCGTTCCGCTTCGAGCTCACCGCCCCCTCGGGCGAGGTCTGGACG
GTCGGCCCCGAGGACGCCACCGAGACGGTCAGCGGTCCCGCGCACGACTTCTGCCTGCTG
GTCACCCGGCGCCGCCACCGCGACGACCTCGCCCTGACCGCGTCTGGTCAGGAGGCGGAG
AAGTGGCTGGACATCGCCCAGGCCTACCGGGGGCCGGCGGGCGAGGGGCGCAGGCCCGGG
CAGTTCGCGGCGACCGGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013917 tRNA wybutosine-synthesis (Domain)
 [183-234]  6.4e-08 PF08608
PF08608   Wyosine_form
IPR017517 Conserved hypothetical protein CHP03083, actinobacterial-type (Family)
 [11-224]  9.40000000000003e-46 TIGR03083
TIGR03083   TIGR03083
IPR017518 Conserved hypothetical protein CHP03084 (Family)
 [6-257]  4.30000000000003e-104 TIGR03084
TIGR03084   TIGR03084
IPR024344 Mycothiol-dependent maleylpyruvate isomerase, metal-binding domain (Domain)
 [14-147]  2.1e-29 PF11716
PF11716   MDMPI_N
SignalP No significant hit
TMHMM No significant hit