close all open/close all

CDS information : C1027_00450


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction58,298 / 57,828 / - [in whole cluster]
58,298 / 57,828 / - [in contig]
Locationcomplement(57828..58298) [in whole cluster]
complement(57828..58298) [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)regulatory protein-like protein
GenesgcE10
Gene (GenBank)
EC number
Keyword
  • TEBC family
  • enediyne core
Note
  • Similar to Hotdog-fold thioesterase.
Note (GenBank)
  • ORF37
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18223152] A phosphopantetheinylating polyketide synthase producing a linear polyene to initiate enediyne antitumor antibiotic biosynthesis. (Proc Natl Acad Sci U S A. , 2008)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q8KNG2
NITE
Calm_00350
PmId
[19357082] Structure and catalytic mechanism of the thioesterase CalE7 in enediyne biosynthesis. (J Biol Chem. , 2009)
ACC
Q84HI7
NITE
Dynm_00190
PmId
[20888341] Induced-fit upon ligand binding revealed by crystal structures of the hot-dog fold thioesterase in dynemicin biosynthesis. (J Mol Biol. , 2010)

close this sectionSequence

selected fasta
>putative thioesterase [regulatory protein-like protein]
MTATNPDYFELRHTVGFEETNLVGNVYYVNYLRWQGRCRELFLKERAPSVLAEVQEDLKL
FTLKVDCEFFAEITAFDELSIRMRLSELRQTQLEFTFDYIKLGDDGGETLVARGRQRIAC
MRGPNTATVPTLIPEALAEALAPYSDRAGSYAGRAA
selected fasta
>putative thioesterase [regulatory protein-like protein]
ATGACCGCGACGAATCCTGACTACTTCGAGCTCCGCCACACCGTCGGCTTCGAGGAGACG
AACCTCGTCGGCAACGTCTACTACGTCAACTACCTTCGTTGGCAGGGGCGTTGCCGGGAA
CTCTTTCTCAAGGAGAGGGCGCCTTCGGTGCTCGCCGAGGTCCAGGAGGACCTCAAGCTC
TTCACCCTCAAGGTGGACTGCGAGTTCTTCGCGGAGATCACCGCCTTCGACGAACTGTCG
ATCCGGATGAGGCTCTCGGAGCTGCGGCAGACCCAGCTGGAGTTCACCTTCGACTACATC
AAGCTGGGCGACGACGGCGGCGAGACCCTGGTGGCGCGGGGACGCCAGCGCATCGCCTGC
ATGCGCGGCCCCAACACGGCGACCGTGCCGACCCTGATACCCGAAGCCCTGGCCGAGGCG
CTCGCGCCCTATTCCGACCGGGCCGGCTCCTACGCGGGACGCGCCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit