close all open/close all

CDS information : C1027_00460


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction60,090 / 58,435 / - [in whole cluster]
60,090 / 58,435 / - [in contig]
Locationcomplement(58435..60090) [in whole cluster]
complement(58435..60090) [in contig]
TypeCDS
Length1,656 bp (551 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
GenesgcE9
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF38
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
P12676
PmId
[2914858] Nucleotide sequence of the gene for cholesterol oxidase from a Streptomyces sp. (J Bacteriol. , 1989)
[10194345] Crystal structure determination of cholesterol oxidase from Streptomyces and structural characterization of key active site mutants. (Biochemistry. , 1999)
Family/Domain
FD
IPR000172, IPR007867

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MSTTAERTDVLVIGSGFGGAIAAYHLAAGGADVTVLERGPWLESKEFEHDYKLGSSYTRA
FDFTVGDGMSILGGNCVGGGSVVYFAAMPRAPRFVFDRQGSIGRRMWPQAVSRETLDPWY
DRVEESLSVTRQDWNDVSYAGGLWAAACNHAGRTANPLAVAIDNTKCVNCNWMMAGCRFE
AKQSLLVNYLPAAIAHGARIRPLHEVQHLSRTPDGSYRVHYNVVHDDDYRLQAGSGVIEA
KIVVMAAGAGATPVILQRSEAHLGTMPRAVGRYFSGNGERLNTAIIDEAKAAELFGLDRG
DGLAYAANQIGKGPTVASWDRLDGSLPEYSRYSLEQLYFPPGLGTILAQVPGATGPSWFG
KEKKEILKQWTSWLTIFTMIEDDNEGVFGPPPATGNAHRISQQMLGRGNLRYDPTKNTLG
AWAASDAEVKEILEKDGLAKVMPWTNDLVGAYTVHPLSSCRMGDDPHTSALDDSNELRDH
PGIFVTDGSSVPGALTVNPAMTIAALAERAMPGIVRAAQSRGISVTYGAPAPDGSTSGRE
RVLPLLPSARG
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGAGCACCACGGCCGAGCGCACGGACGTCCTCGTCATCGGCAGCGGATTCGGCGGTGCC
ATCGCCGCCTACCACCTGGCGGCGGGGGGCGCCGACGTCACCGTCCTGGAACGCGGGCCG
TGGCTGGAGAGCAAGGAGTTCGAGCACGACTACAAACTCGGCTCCTCGTACACGAGGGCG
TTCGACTTCACGGTCGGGGACGGCATGAGCATCCTCGGCGGGAACTGTGTGGGCGGCGGC
AGCGTCGTCTACTTCGCCGCGATGCCCCGCGCCCCGCGCTTCGTCTTCGACCGGCAGGGG
TCCATAGGACGCCGGATGTGGCCGCAGGCGGTGAGCCGCGAAACCCTGGACCCCTGGTAC
GACCGTGTCGAGGAGTCCCTCTCCGTGACCCGGCAGGACTGGAACGACGTGAGCTACGCC
GGCGGACTGTGGGCCGCGGCGTGCAACCACGCCGGCCGCACCGCCAACCCCCTCGCCGTC
GCCATCGACAACACCAAGTGCGTGAACTGCAACTGGATGATGGCCGGCTGCCGCTTCGAG
GCCAAGCAGTCCTTGCTGGTCAACTACCTGCCCGCCGCCATCGCCCATGGGGCGCGCATC
CGCCCGCTGCACGAGGTCCAGCACCTCTCGCGCACCCCCGACGGCTCCTACCGGGTGCAC
TACAACGTCGTGCACGACGACGACTACCGCCTCCAGGCGGGCAGCGGCGTCATCGAGGCG
AAGATCGTGGTGATGGCGGCCGGCGCGGGCGCGACCCCGGTGATCCTCCAGCGCAGCGAG
GCCCACCTGGGCACCATGCCACGAGCGGTCGGACGCTACTTCTCCGGCAACGGCGAGCGG
CTCAACACCGCCATCATCGACGAGGCCAAGGCGGCCGAGCTGTTCGGCCTGGACCGGGGC
GACGGGCTCGCCTACGCGGCCAACCAGATCGGCAAGGGGCCCACCGTGGCGAGCTGGGAC
AGGCTGGACGGCTCGTTGCCCGAGTACTCCCGCTACTCCCTGGAACAGCTCTACTTCCCG
CCGGGCCTCGGCACGATCCTCGCCCAGGTGCCCGGCGCCACGGGCCCCTCCTGGTTCGGC
AAGGAGAAGAAGGAGATCCTGAAGCAGTGGACCTCCTGGCTCACGATCTTCACGATGATC
GAGGACGACAACGAAGGCGTCTTCGGCCCCCCTCCCGCCACCGGTAACGCCCACCGCATC
TCCCAGCAGATGCTCGGCCGGGGCAACCTGCGCTACGACCCGACGAAGAACACCCTGGGC
GCCTGGGCCGCATCCGACGCCGAGGTCAAGGAGATCCTGGAGAAGGACGGCCTGGCCAAG
GTCATGCCCTGGACCAACGACCTCGTCGGCGCCTACACCGTCCACCCGCTCTCCTCCTGC
CGGATGGGCGACGACCCCCACACATCCGCCCTGGACGACAGCAACGAGCTCCGCGACCAC
CCGGGGATCTTCGTCACCGACGGATCGTCGGTTCCCGGCGCGCTGACGGTCAATCCCGCG
ATGACCATCGCGGCGCTCGCCGAACGCGCGATGCCGGGGATCGTGCGCGCCGCGCAGAGC
CGGGGTATCTCCGTCACCTACGGCGCACCGGCCCCCGACGGCTCCACGAGCGGCCGCGAG
AGGGTTCTTCCCCTGCTGCCGTCGGCGCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [9-259]  3.39999999999999e-17 PF00732
PF00732   GMC_oxred_N
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [450-510]  1e-15 PF05199
PF05199   GMC_oxred_C
SignalP No significant hit
TMHMM No significant hit