close all open/close all

CDS information : C1027_00470


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction60,677 / 60,087 / - [in whole cluster]
60,677 / 60,087 / - [in contig]
Locationcomplement(60087..60677) [in whole cluster]
complement(60087..60677) [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative regulatory protein
GenesgcE8
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF39
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [putative regulatory protein]
MESELRDDNERGAPAGDIRTMTLEAYADTIVPGQKRFADDRAIAGVSTGGGAVQAGALEL
LQWDATGIHEGLDDLVRLVNEHALAYAAERRLAPDPTVPPFVALDYPDRAALIQRLTTPG
HPEKEFWVLLSLFCNMAFDSAAHLNTAQAMEDGHPGLEAMGLSMPDADGLWRFKDYSYGR
EFARLHPDTTSTGSPA
selected fasta
>hypothetical protein [putative regulatory protein]
ATGGAGAGCGAGTTGCGCGACGACAATGAGCGAGGGGCGCCGGCCGGCGATATCCGGACC
ATGACCCTGGAGGCCTACGCGGACACGATCGTGCCGGGCCAGAAGCGCTTCGCGGACGAC
CGGGCCATCGCGGGGGTGTCCACCGGCGGTGGCGCCGTCCAGGCGGGAGCCCTGGAGCTC
CTGCAATGGGATGCGACCGGCATCCACGAGGGTCTGGACGACCTGGTGCGCCTGGTGAAC
GAGCACGCGCTGGCCTACGCGGCGGAGCGCCGCCTGGCTCCCGACCCGACGGTCCCGCCC
TTCGTGGCGCTCGACTACCCGGACCGGGCCGCGCTGATCCAGCGGCTGACGACACCAGGC
CACCCCGAGAAGGAGTTCTGGGTGCTGCTGTCCCTCTTCTGCAACATGGCCTTCGATTCG
GCCGCGCACCTCAACACGGCACAGGCGATGGAGGACGGCCATCCGGGACTGGAGGCCATG
GGCCTGAGCATGCCGGACGCCGACGGCCTGTGGCGCTTCAAGGATTACAGCTACGGGCGT
GAGTTCGCCCGCCTCCACCCCGACACCACGTCCACCGGGAGCCCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit