close all open/close all

CDS information : C1027_00480


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction60,935 / 62,014 / + [in whole cluster]
60,935 / 62,014 / + [in contig]
Location60935..62014 [in whole cluster]
60935..62014 [in contig]
TypeCDS
Length1,080 bp (359 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)regulatory protein
GenesgcR1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF40
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)

close this sectionSequence

selected fasta
>transcriptional activator [regulatory protein]
MKSDSAQRAVERSRRVVRIDELIPADSPRLNGIDRSHVQRLATVYASLPPVLVHRPTMRV
VDGMHRIGAARLKGLDTVEVTFFEGAEEQVFLRSVAANITNGLPLSVADRKTAAARILAS
HPTLSDRAVAAHVGLDAKTVAGVRTCSAAGSPLLNMRTGADGRVHPLDRTAERLHAAALL
TQDPGLPLRSVVEQTGLSLGTAHDVRRRLLRGEDPVPQNRQSAMLEPGLAPQKKATAKPP
VGPAARPVPKVPPAVAGRPPVSPRSRAPLEALRKLSNDPSLRHSDQGRELMRWLHNRFVV
DEAWRRRADAVPAHCVDSMAELAQHCSDAWHRFAEEMVRRRHSAAADGSGLRTTQPTRR
selected fasta
>transcriptional activator [regulatory protein]
GTGAAAAGTGACTCTGCCCAACGCGCCGTGGAGCGATCACGCCGTGTCGTACGGATCGAT
GAACTCATTCCCGCCGATTCCCCGCGCCTGAACGGAATCGATCGTTCCCATGTGCAGCGC
CTCGCGACCGTGTACGCGTCCCTGCCGCCGGTCCTGGTGCACCGCCCGACCATGCGGGTC
GTCGACGGCATGCACCGCATCGGCGCGGCCCGCCTGAAGGGGCTGGACACGGTCGAGGTC
ACCTTCTTCGAGGGCGCCGAGGAGCAGGTGTTCCTGCGTTCCGTCGCGGCGAACATCACC
AACGGCCTGCCGTTGTCGGTGGCCGACCGCAAGACCGCCGCGGCCCGCATTCTGGCCTCC
CACCCGACCCTGTCCGACCGCGCGGTCGCCGCACACGTCGGCCTCGACGCCAAGACCGTG
GCGGGGGTACGGACGTGTTCAGCCGCGGGTTCTCCGCTGCTGAACATGCGCACCGGGGCG
GACGGCCGCGTCCACCCGTTGGACCGCACCGCCGAACGCCTGCACGCGGCCGCGCTGCTG
ACCCAGGACCCGGGACTCCCGTTGCGCTCCGTCGTCGAGCAGACGGGGCTGTCGCTGGGC
ACGGCCCACGACGTCCGCCGTCGGCTGCTGCGGGGCGAGGACCCGGTCCCGCAGAACCGG
CAGAGCGCGATGCTGGAGCCGGGACTCGCCCCGCAGAAGAAGGCGACGGCCAAGCCGCCC
GTCGGCCCGGCCGCCCGTCCGGTCCCGAAGGTGCCGCCCGCCGTCGCCGGCAGGCCGCCG
GTGTCACCGCGGTCCCGGGCCCCGCTGGAGGCGCTGCGCAAGCTCTCCAACGACCCCTCC
CTGCGCCACTCCGACCAGGGGCGCGAACTCATGCGCTGGCTGCACAACCGGTTCGTCGTC
GACGAGGCGTGGCGCCGGCGCGCGGACGCGGTCCCGGCCCACTGCGTCGACTCGATGGCG
GAGCTGGCGCAGCACTGCTCGGACGCCTGGCACCGGTTCGCCGAGGAGATGGTTCGGCGC
CGGCACAGCGCCGCGGCCGACGGCTCCGGACTCCGCACGACTCAGCCAACTCGCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [17-99]  9.10000000000001e-07 PF02195
PF02195   ParBc
 [14-101]  1.49999977583352e-08 SSF110849
SSF110849   ParBc
SignalP No significant hit
TMHMM No significant hit