close all open/close all

CDS information : C1027_00490


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction62,040 / 62,894 / + [in whole cluster]
62,040 / 62,894 / + [in contig]
Location62040..62894 [in whole cluster]
62040..62894 [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductAraC family transcriptional activator
Product (GenBank)putative regulatory protein
GenesgcR2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF41
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)

close this sectionSequence

selected fasta
>AraC family transcriptional activator [putative regulatory protein]
MTTNTIEDAVRRVVEYMHVNLGQNLTIDDMARTAMFSKFHFTRIFREVTGTSPGRFLSAL
RIQEAKRLLVHTALSVADISSQVGYSSVGTFSSRFKACVGLSPSAYRDFGGVQPGFPSAA
ARLTPTAHNPSVRGRIHSAPGDRPGRIFVGLFPGRMRQGRPARWTVMESPGAFELRDVPV
GTWHILVHSFPAGHRPHQLDSEPLLLGHSGPLVVHPGALLRPADILLRAVDALDPPVLLA
HFALESRLTSPYSPSSVALRASAGRAWVRQPPGVRRRYADRDRG
selected fasta
>AraC family transcriptional activator [putative regulatory protein]
GTGACCACGAACACCATCGAGGACGCGGTCCGCCGGGTCGTCGAGTACATGCACGTCAAC
CTGGGTCAGAACCTCACGATCGATGACATGGCGCGCACGGCGATGTTCAGCAAGTTCCAT
TTCACCCGCATCTTCCGCGAAGTCACCGGTACCTCTCCCGGGCGTTTCCTGTCCGCCTTA
CGGATTCAGGAGGCCAAGAGACTTCTCGTGCACACTGCACTCAGTGTGGCCGATATCAGC
AGTCAGGTCGGCTACAGCAGTGTCGGTACTTTCAGTTCTCGCTTCAAGGCCTGTGTGGGG
CTTTCCCCGAGCGCCTATCGCGACTTCGGCGGGGTGCAGCCGGGTTTTCCCTCCGCCGCG
GCCCGTCTCACTCCCACCGCGCACAATCCCTCCGTGCGCGGCCGCATTCACTCCGCCCCG
GGTGACAGGCCCGGAAGGATCTTCGTGGGCCTGTTCCCCGGCAGGATGCGCCAGGGCCGC
CCGGCGCGCTGGACCGTCATGGAGAGTCCCGGGGCCTTCGAGCTCCGGGACGTGCCCGTG
GGCACCTGGCACATCCTGGTCCACTCCTTCCCCGCCGGACACCGGCCGCACCAGCTCGAC
TCCGAACCGCTGTTGCTCGGGCACAGCGGACCGCTCGTGGTGCACCCCGGTGCCCTGCTC
CGGCCGGCGGACATCCTCCTGCGCGCGGTGGACGCCCTCGATCCACCGGTCCTGCTGGCC
CACTTCGCGCTGGAGAGCCGCCTCACCTCGCCGTACTCACCGTCATCGGTAGCCCTCCGC
GCATCCGCAGGGAGAGCATGGGTTCGGCAACCGCCCGGTGTCCGGCGACGGTACGCAGAT
CGAGATCGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [7-60]  1e-25 G3DSA:1.10.10.60 [61-108]  1.3e-21 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [6-57]  2.70000183580794e-11 SSF46689 [60-108]  1.29999924468179e-13 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [24-107]  1.3000049540733e-33 SM00342
SM00342   HTH_ARAC
 [11-109]  PS01124
PS01124   HTH_ARAC_FAMILY_2
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [61-103]  PS00041
PS00041   HTH_ARAC_FAMILY_1
IPR020449 Transcription regulator HTH, AraC- type (Family)
 [76-91]  8.59999720482718e-06 PR00032 [91-107]  8.59999720482718e-06 PR00032
PR00032   HTHARAC
SignalP No significant hit
TMHMM No significant hit