close all open/close all

CDS information : C1027_00500


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction64,131 / 62,782 / - [in whole cluster]
64,131 / 62,782 / - [in contig]
Locationcomplement(62782..64131) [in whole cluster]
complement(62782..64131) [in contig]
TypeCDS
Length1,350 bp (449 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450 hydroxylase
GenesgcE7
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF42
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
O23365
PmId
[19939422] Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions. (Phytochemistry. , 2010)
Family/Domain
FD
IPR001128

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 hydroxylase]
MRIDPPGPPLRALPGLLRKLAVDRLGMMRDAAGLGDAVRVSMGPKKLYIFNRPDYAKHVL
ADNSDNYHKGIGLVQSRRVLGDGLLTSDGETWREQRRIVQPAFKPGRINQQAAAVAEEAA
KLVALLRGHEGGGPVDVLQEVTGLTLGVLGRTLLDSNLTAHESLAHSFEEVQDQAMLEMV
SQGTVPAWLPLPPQARFRRARRELYRVADLLVADRRSRMADGGPGDDALSRIIVAADRRR
DDPARARNRLREELVTLLLAGHETTASTLGWTLHLLERHPEVRDRVRAEARAALGDGVPG
PEDLHRLTYTTMVVQEAMRLFPPVWILPRVAQQRDVVGGYTVSAGSDVLVCPYIMHRHPG
LWEDPERFDPERFEPRQTADRPRYAYIPFGAGPRFCVGSNLGMMEAVFVTALVTRDLDLR
TVAGHRAVAEPMLSLRMRGGLPMTVSTAR
selected fasta
>putative cytochrome P450 [P450 hydroxylase]
ATGAGGATCGACCCGCCCGGCCCGCCCCTCCGGGCGCTTCCGGGACTGCTGAGAAAGCTG
GCGGTGGACCGCCTCGGGATGATGAGGGACGCGGCCGGGCTCGGGGACGCCGTCCGCGTC
TCCATGGGGCCCAAGAAGCTGTACATCTTCAACCGCCCCGACTACGCCAAGCACGTCCTG
GCGGACAACAGCGACAACTACCACAAGGGCATCGGTCTGGTGCAGTCCCGCCGGGTGCTG
GGCGACGGGCTGCTCACCAGTGACGGTGAGACGTGGCGCGAACAGCGCAGGATCGTGCAG
CCGGCGTTCAAACCGGGCCGCATCAACCAGCAGGCGGCCGCCGTCGCCGAGGAGGCGGCC
AAGCTGGTCGCCCTGCTGCGCGGTCACGAGGGGGGCGGTCCCGTGGACGTTCTCCAGGAG
GTCACCGGTCTCACCCTAGGCGTACTGGGCCGGACCCTGCTCGACTCGAACCTCACCGCG
CACGAGTCGCTCGCCCACTCCTTCGAGGAGGTCCAGGACCAGGCCATGCTGGAAATGGTG
AGCCAGGGCACGGTGCCGGCCTGGCTGCCGCTGCCTCCGCAAGCACGCTTCCGGCGCGCC
CGCAGGGAGCTGTACCGGGTGGCCGACCTGCTGGTGGCCGACCGGCGCTCCAGGATGGCC
GACGGCGGGCCGGGCGACGACGCGCTGTCCCGGATCATCGTCGCCGCGGACAGGCGCCGG
GACGACCCCGCCCGGGCTCGCAACAGGCTGCGCGAGGAACTGGTCACCCTGCTCCTGGCG
GGCCACGAGACCACTGCCAGTACGCTCGGCTGGACCCTGCATCTGCTGGAACGTCACCCC
GAGGTACGTGACCGGGTCCGCGCGGAGGCCCGTGCCGCCCTCGGCGACGGCGTCCCCGGA
CCGGAGGACCTGCATCGGCTGACGTACACCACGATGGTGGTGCAGGAGGCGATGCGGCTG
TTCCCTCCCGTGTGGATCCTGCCCAGGGTGGCCCAGCAACGCGATGTGGTCGGCGGCTAC
ACGGTGTCCGCCGGATCGGATGTGCTGGTCTGCCCGTACATCATGCACCGCCATCCGGGG
CTGTGGGAGGACCCCGAGCGCTTCGACCCCGAGCGGTTCGAACCCCGGCAGACCGCCGAC
CGGCCGCGGTACGCGTACATCCCGTTCGGCGCGGGGCCCCGGTTCTGCGTCGGCAGCAAC
CTCGGGATGATGGAGGCGGTGTTCGTCACGGCCCTGGTCACCCGCGATCTCGATCTGCGT
ACCGTCGCCGGACACCGGGCGGTTGCCGAACCCATGCTCTCCCTGCGGATGCGCGGAGGG
CTACCGATGACGGTGAGTACGGCGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [260-277]  2.09999806691534e-13 PR00385 [312-323]  2.09999806691534e-13 PR00385 [387-396]  2.09999806691534e-13 PR00385 [396-407]  2.09999806691534e-13 PR00385
PR00385   P450
 [32-420]  4.2e-76 PF00067
PF00067   p450
 [5-446]  2.99999999999998e-110 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [5-445]  3.49999466863949e-112 SSF48264
SSF48264   Cytochrome_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [31-50]  2.19999900980708e-21 PR00463 [249-266]  2.19999900980708e-21 PR00463 [269-295]  2.19999900980708e-21 PR00463 [351-375]  2.19999900980708e-21 PR00463 [386-396]  2.19999900980708e-21 PR00463 [396-419]  2.19999900980708e-21 PR00463
PR00463   EP450I
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [389-398]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit