close all open/close all

CDS information : C1027_00510


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction64,676 / 64,128 / - [in whole cluster]
64,676 / 64,128 / - [in contig]
Locationcomplement(64128..64676) [in whole cluster]
complement(64128..64676) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNADH-dependent FAD reductase
Product (GenBank)oxidoreductase
GenesgcE6
Gene (GenBank)
EC number
Keyword
  • two-component system
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF45
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19817865] Characterization of SgcE6, the flavin reductase component supporting FAD-dependent halogenation and hydroxylation in the biosynthesis of the enediyne antitumor antibiotic C-1027. (FEMS Microbiol Lett. , 2009)

close this sectionSequence

selected fasta
>NADH-dependent FAD reductase [oxidoreductase]
MSPIIAPPAELVDPKDRVQLRRVFGDFPTGVTVVTVGGSEPRGMTANSFTSVSLSPPLVL
ICVGKDAVMHQRLTALPTFAVSVLEAGQEKAARHFADHSRPPGVDQFDTVDWVLGEESGA
PLIAGAVAHLECAIHRLYEGGDHTIFLGEVITATRWPAREGMLFSGGRFRRFAPDADEGR
AA
selected fasta
>NADH-dependent FAD reductase [oxidoreductase]
ATGAGTCCGATCATCGCTCCGCCCGCAGAACTGGTCGACCCGAAAGACCGCGTACAGCTC
AGGAGGGTGTTCGGGGACTTCCCGACCGGCGTCACCGTGGTGACCGTCGGCGGGAGCGAG
CCCCGGGGAATGACCGCCAACTCGTTCACATCCGTCTCGCTCTCACCCCCCCTGGTGCTG
ATCTGCGTCGGCAAGGACGCCGTCATGCACCAACGCCTCACCGCGCTGCCGACGTTCGCC
GTATCGGTGCTGGAGGCCGGGCAGGAGAAGGCCGCCAGGCACTTCGCGGACCACTCGCGC
CCCCCGGGCGTGGACCAGTTCGACACCGTGGACTGGGTGCTCGGAGAGGAATCCGGCGCA
CCGCTGATCGCGGGTGCGGTGGCCCACCTGGAATGTGCGATACACCGGCTCTACGAAGGC
GGCGACCACACCATCTTCCTCGGCGAGGTCATCACGGCGACGCGCTGGCCGGCCCGCGAG
GGGATGCTGTTCTCCGGCGGCCGCTTCCGCCGCTTCGCTCCGGATGCGGACGAAGGAAGG
GCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [25-171]  1.2e-34 PF01613
PF01613   Flavin_Reduct
 [24-171]  6.39998633403535e-53 SM00903
SM00903   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [12-180]  9.69997533354407e-50 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [16-174]  5.69999999999998e-54 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit