close all open/close all

CDS information : C1027_00520


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction70,576 / 64,757 / - [in whole cluster]
70,576 / 64,757 / - [in contig]
Locationcomplement(64757..70576) [in whole cluster]
complement(64757..70576) [in contig]
TypeCDS
Length5,820 bp (1,939 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GenesgcE
Gene (GenBank)
EC number
Keyword
  • iterative
  • enediyne core
Note
Note (GenBank)
  • ORF46
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[14528002] Rapid PCR amplification of minimal enediyne polyketide synthase cassettes leads to a predictive familial classification model. (Proc Natl Acad Sci U S A. , 2003)
[18223152] A phosphopantetheinylating polyketide synthase producing a linear polyene to initiate enediyne antitumor antibiotic biosynthesis. (Proc Natl Acad Sci U S A. , 2008)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
Related Reference
ACC
Q8KNG1
NITE
Calm_00360
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18529057] Characterization of a carbonyl-conjugated polyene precursor in 10-membered enediyne biosynthesis. (J Am Chem Soc. , 2008)
[18319060] Evidence for a novel phosphopantetheinyl transferase domain in the polyketide synthase for enediyne biosynthesis. (FEBS Lett. , 2008)
[19689130] Production of octaketide polyenes by the calicheamicin polyketide synthase CalE8: implications for the biosynthesis of enediyne core structures. (J Am Chem Soc. , 2009)
[21674045] Solution structures of the acyl carrier protein domain from the highly reducing type I iterative polyketide synthase CalE8. (PLoS One. , 2011)
[23009853] Rigidifying acyl carrier protein domain in iterative type I PKS CalE8 does not affect its function. (Biophys J. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[23042574] Environmental control of the calicheamicin polyketide synthase leads to detection of a programmed octaketide and a proposal for enediyne biosynthesis. (Angew Chem Int Ed Engl. , 2012)
[24041368] Biochemical determination of enzyme-bound metabolites: preferential accumulation of a programmed octaketide on the enediyne polyketide synthase CalE8. (J Am Chem Soc. , 2013)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
ACC
Q84HI8
NITE
Dynm_00180
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[22589546] Crystal structure of the acyltransferase domain of the iterative polyketide synthase in enediyne biosynthesis. (J Biol Chem. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)

close this sectionPKS/NRPS Module

A1 acetyl-CoA
malonyl-CoA
KS2..411
AT619..847
ACP929..1021
KR1203..1383
DH1453..1608
PPT1710..1923

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MSRIAIVGVACTYPDATTPRELWENAVAGRRAFRRLPDVRMRLDDYWNPDPTVPDTFYAR
NAAVLEGWEFDRVAHRIAGSTFRSTDLTHWLALDTATRALADAGFPAGEGLPTERTGVVV
GNTLTGEFSRANGLRLRWPYVRRILADALQEQEWDDDRLGAFLRGVEEAYKKPFPAVDED
TLAGGLSNTIAGRICNHFDLNGGGYTVDGACSSSLLSITTAATSLQSGDLDVAVAGGVDL
SIDPFEIIGFAKTGALARKEMRLYDRGSNGFWPGEGCGMVVLMREEDAVASGHRIYASIA
GWGISSDGQGGITRPEVSGYQLALSRAYDRAGFGIETVPLFEGHGTGTAVGDATELRAIM
SARAAADPHAPSAVITSIKGMIGHTKAAAGIAGLIKAVMALDSGVLPPAIGCVDPHDLLT
DESANLRVLRKAESWPENAPLRAGITAMGFGGINTHVVLDRSDASGRRPAVNRRTTLLAN
SLQDSELLLLDGESPAALARRLTQVADFAAQVSYAQLGDLAATLQRELRDLPHRAAVVAT
SPEDAELRLRGLAETAGGRAPDDGPVFSQDGRAFLGTAAEGARVGFLFPGQGSGTSTAGG
ALARRFTEAAEVYARAGLPTAGDMVATHVAQPRIVTGSTAGLRVLEALGIEADIALGHSL
GELSALHWAGALDETTLLEAARTRGAAMAAHSASGTMASLTATPEEAVRLVEGLPVVISG
YNGPRQTVVAGTVEAVESVGERAAAAEIAFTRLAVSHAFHSPLVAPAAESFGDWLAKAPL
GGLGRRVVSTVTGAELERDTDLAKLLRQQITDPVLFTQAVRAAAAEVDLFVEVGPGRVLS
VLAAETAGKPAVALNTDDESLRGLLQVVGAAFVIGAPIIHERLFNDRLTRPLEVGKEFLF
LSSPCEQAPEFTLPAAAREPLVQEHDAPTTAGAGDTAEESALDVLRALVAERAELPSELI
DENSSLLDDLHMSSITVGQIVNQTAVRLGLAPSSIPTNFATATLAELASALTTLVETGAD
PTAAPVVTGSAAWARPFSVDLDELPLPPAVADEKDGTWELFTSADHPFAEEVRRALQDAA
VGSGVLVCLPAGCSPDQLELALDGARSALAGSQEGRFVLVQHDRGAAGLAKTLHLEAPHL
RTTVVHTPVADGAADRVAAEVAATTHFSEVHLDRDGTRRVPVLRALPFAPDRTDQVLGPD
DVLLVTGGGKGITAECALAVAERTGAALAVLGRSDPGSDQDLAANLGRMRESGIRVAYAA
ADVTDPVRVAGAVAELTGALGSVTAVLHGAGRNEPTALGGLDMAAVRSTLAPKVDGLRHV
LDVVGEQNLRLLVTFGSIIGRAGLRGEAHYATANEWLAGLTEDVARRNPDCRALCMEWSV
WSGVGMGEKLSVVESLSREGIVPVSPDQGIEILLRLISDPDAPVVTVISGRTEGIGTVRR
EQPPLPLLRFTGEPLVRYHGVELVTEAELNAGTDLYLTDHMLDGNLLLPAVIGMEAMVQV
GSAVTGRRDVPVIEDARFLRPIVVPPGGTTRIRIAATVTGTDRVDVAVHAQDTGFAAEHF
RARLVYGGAAIPDGAPDQVGPKVPTAPLDPATDLYGGVLFQGERFQRLRRFHRAAARHVD
AEVALDTASGWFAGFLPGTLLLSDPGMRDALMHGNQVCVPDATLLPSGIERLYPMAAGED
LPELVRYCATERHRDGDTYVYDIAVRTPDGSVVERWDGLTLHAVRKSDGSGPWVAPLLGS
YLERTLEEVLGTHVDVAVEPVPADSGGSVADRRKATARAVQRALGESVKVRYRPDGRPEL
DGVRRLSAAHGPGVTLGVVGTTTVACDIEAVTARGAQEWEGLLGEHGNLAALVAKETGET
PDHAATRVWTAVECLKKAGLPAGAPLTLEPQVRSGWIVLTAGGLRIATFATTLRHVEEPV
VLAFLTAGTDDAAPGSARA
selected fasta
>polyketide synthase [polyketide synthase]
ATGAGCCGCATAGCCATCGTCGGAGTCGCGTGCACGTACCCCGACGCCACCACCCCCCGG
GAGCTCTGGGAGAACGCCGTCGCCGGACGGCGGGCCTTCCGCAGACTGCCCGACGTCCGG
ATGCGGTTGGACGACTACTGGAACCCGGACCCCACGGTCCCCGACACCTTCTACGCCCGC
AATGCGGCGGTGCTGGAGGGCTGGGAGTTCGACCGCGTCGCCCACCGGATCGCCGGCAGC
ACCTTCCGCTCCACCGACCTCACCCACTGGCTCGCCCTGGACACGGCGACCCGAGCGCTG
GCGGACGCCGGCTTCCCGGCCGGTGAGGGGCTGCCCACCGAGCGCACCGGAGTCGTCGTC
GGCAACACGCTGACCGGAGAGTTCTCCCGCGCCAACGGCCTGCGACTGCGATGGCCCTAC
GTACGCCGGATCCTCGCCGACGCCCTCCAGGAGCAGGAGTGGGACGACGACCGCCTCGGC
GCATTCCTCCGAGGCGTGGAGGAGGCGTACAAGAAGCCCTTCCCCGCCGTGGACGAGGAC
ACCCTCGCGGGGGGCCTGTCCAACACCATCGCCGGGCGGATCTGCAACCACTTCGACCTG
AACGGCGGCGGCTACACCGTCGACGGCGCCTGCTCGTCCTCGCTGTTGTCCATCACCACC
GCGGCCACCTCGCTGCAGAGCGGCGACCTCGACGTGGCCGTCGCCGGTGGCGTCGATCTG
TCCATCGACCCGTTCGAGATCATCGGTTTCGCCAAGACCGGGGCGCTCGCCCGCAAGGAG
ATGCGGCTCTACGACCGCGGATCCAACGGCTTCTGGCCGGGCGAGGGCTGCGGCATGGTG
GTCCTCATGCGCGAGGAGGACGCGGTCGCCTCCGGGCACCGCATCTACGCGTCCATCGCC
GGCTGGGGCATCTCGTCCGACGGCCAGGGAGGCATCACCCGGCCCGAGGTGAGCGGGTAT
CAGCTCGCGCTGTCGCGCGCCTACGACCGGGCGGGCTTCGGCATCGAGACCGTGCCGCTC
TTCGAGGGCCACGGCACCGGCACCGCCGTCGGTGACGCCACCGAACTCCGGGCGATCATG
AGTGCGCGCGCCGCAGCCGACCCCCACGCCCCGAGCGCCGTCATCACCTCCATCAAGGGC
ATGATCGGCCACACCAAGGCGGCAGCGGGGATCGCCGGACTGATCAAGGCGGTGATGGCC
CTGGACTCCGGGGTGCTGCCCCCCGCCATCGGCTGCGTGGACCCCCACGACCTGCTCACC
GACGAGTCCGCCAACCTGCGCGTCCTGCGCAAGGCGGAGTCCTGGCCCGAGAACGCGCCG
CTGCGGGCCGGCATCACCGCCATGGGCTTCGGCGGGATCAACACCCATGTCGTCCTCGAC
AGGTCGGACGCCTCCGGGCGCCGCCCTGCCGTCAACCGCCGGACCACGCTGCTGGCCAAC
TCCCTCCAGGACTCCGAACTGCTGCTCCTGGACGGGGAATCGCCCGCGGCGCTGGCACGG
CGGCTGACCCAGGTCGCCGACTTCGCCGCGCAGGTCTCCTATGCCCAGCTCGGCGATCTG
GCCGCGACCCTCCAGCGGGAACTGCGCGACCTGCCCCACCGGGCCGCCGTCGTGGCCACC
TCGCCGGAGGACGCCGAGCTCAGGCTGCGCGGACTGGCCGAAACCGCCGGGGGGCGGGCG
CCCGACGACGGCCCGGTCTTCTCCCAGGACGGCCGCGCCTTCCTCGGCACCGCCGCCGAG
GGAGCCCGCGTCGGCTTCCTCTTCCCGGGACAGGGTTCCGGCACTTCGACGGCCGGGGGC
GCGCTCGCCCGCAGGTTCACCGAGGCCGCCGAGGTCTACGCGCGCGCAGGCCTTCCCACC
GCTGGAGACATGGTCGCCACCCATGTGGCCCAGCCGCGGATCGTGACCGGTTCCACGGCC
GGACTCCGGGTGCTGGAAGCTCTGGGAATCGAGGCCGACATCGCACTCGGCCACAGTCTC
GGCGAGCTCTCCGCCCTGCACTGGGCGGGTGCGCTGGACGAGACCACGCTGCTGGAGGCC
GCGCGCACCCGCGGTGCGGCCATGGCCGCACACAGCGCTTCGGGCACGATGGCCTCCCTG
ACGGCCACCCCGGAGGAGGCGGTCAGGCTCGTCGAGGGGCTGCCGGTCGTGATCTCCGGG
TACAACGGCCCCCGGCAGACGGTGGTCGCCGGGACCGTCGAGGCCGTGGAGAGTGTCGGG
GAGCGGGCGGCGGCCGCGGAGATCGCCTTCACCCGTCTGGCCGTGTCGCACGCTTTCCAC
TCCCCTCTCGTCGCCCCGGCCGCCGAGTCCTTCGGCGACTGGCTGGCAAAGGCTCCGCTG
GGTGGGCTGGGACGCCGGGTCGTCTCCACCGTCACCGGTGCGGAGCTGGAGCGCGACACC
GATCTCGCCAAGCTGCTGCGGCAGCAGATCACCGACCCGGTGCTGTTCACCCAGGCGGTC
CGGGCGGCGGCGGCCGAGGTCGACCTGTTCGTCGAGGTCGGGCCCGGCCGGGTGCTGAGC
GTCCTGGCCGCGGAGACCGCCGGGAAACCCGCCGTCGCGCTGAACACCGACGACGAGTCG
CTGCGCGGGCTGCTGCAAGTGGTCGGCGCCGCCTTCGTGATCGGGGCCCCGATCATTCAC
GAGCGGCTCTTCAACGACCGGCTGACCCGGCCGTTGGAGGTGGGCAAGGAGTTCCTCTTC
CTGTCCAGCCCCTGCGAGCAGGCCCCCGAGTTCACGCTTCCCGCCGCCGCTCGTGAACCG
CTCGTCCAGGAGCACGACGCCCCGACGACCGCGGGCGCCGGCGACACGGCGGAGGAGTCG
GCGCTGGACGTGCTGCGCGCACTGGTGGCCGAGCGGGCGGAGCTTCCGAGCGAGTTGATC
GACGAGAACAGCAGTCTCCTCGACGATCTGCACATGAGCTCGATCACCGTCGGCCAGATC
GTCAACCAGACGGCTGTCCGGCTCGGACTCGCCCCGTCCAGCATTCCGACGAACTTCGCC
ACGGCGACCCTGGCGGAACTGGCGTCGGCCCTCACGACCCTGGTCGAGACGGGTGCGGAC
CCGACGGCGGCGCCCGTCGTGACCGGGTCCGCGGCCTGGGCCCGGCCCTTCTCCGTCGAC
CTCGACGAACTGCCCCTCCCTCCGGCGGTGGCGGATGAGAAGGACGGCACGTGGGAGCTG
TTCACCTCCGCCGACCACCCGTTCGCCGAGGAAGTCCGGCGCGCTCTCCAGGACGCCGCG
GTGGGTTCCGGAGTTCTGGTGTGCCTGCCGGCCGGCTGCTCCCCTGATCAGCTCGAACTC
GCCCTGGACGGGGCGAGATCGGCCCTCGCGGGCAGCCAGGAGGGACGCTTCGTCCTGGTG
CAGCACGACCGGGGCGCGGCCGGTCTGGCCAAGACCCTGCACCTGGAGGCGCCCCACCTG
CGAACCACCGTCGTCCACACTCCGGTGGCCGACGGAGCCGCGGACCGGGTGGCAGCCGAG
GTCGCGGCGACCACGCACTTCAGCGAGGTGCACCTCGACCGGGACGGCACCCGGCGGGTG
CCCGTGCTGCGGGCCCTGCCCTTCGCCCCGGACCGTACCGACCAGGTGCTGGGCCCGGAC
GACGTCCTGCTCGTCACGGGCGGCGGCAAGGGCATCACCGCCGAGTGCGCGCTGGCCGTC
GCCGAGCGGACCGGCGCGGCGCTGGCCGTGCTGGGCCGCTCGGACCCGGGCAGCGACCAG
GACCTCGCCGCGAACCTGGGACGGATGAGGGAGAGCGGGATACGCGTCGCCTACGCGGCC
GCCGACGTCACCGATCCGGTGCGCGTCGCCGGGGCCGTCGCCGAACTGACCGGGGCACTC
GGATCCGTGACCGCTGTCCTGCACGGTGCGGGACGCAACGAGCCGACTGCGCTCGGCGGG
CTGGACATGGCCGCCGTCCGCAGCACGCTCGCCCCCAAGGTCGACGGGCTGCGGCACGTG
CTGGACGTGGTCGGCGAGCAGAACCTCAGACTCCTGGTCACCTTCGGCAGCATCATCGGC
CGGGCGGGGCTTCGAGGGGAGGCCCACTACGCCACGGCCAACGAGTGGCTGGCCGGACTC
ACCGAGGACGTGGCCCGCCGGAACCCGGACTGCCGGGCGCTGTGCATGGAATGGTCCGTC
TGGTCCGGCGTCGGCATGGGCGAGAAGCTGTCCGTCGTCGAGTCCCTCTCCCGCGAGGGC
ATCGTGCCGGTCTCGCCCGACCAGGGCATCGAGATCCTGCTGCGTCTGATCTCCGACCCC
GACGCCCCGGTGGTGACGGTGATCAGCGGCCGGACGGAAGGCATCGGAACCGTCCGGCGC
GAGCAGCCCCCGCTGCCGCTGCTGCGTTTCACCGGGGAGCCCCTGGTGCGCTACCACGGC
GTGGAACTCGTCACCGAGGCAGAACTGAACGCCGGCACGGACCTCTACCTCACCGACCAC
ATGCTGGACGGCAACCTGCTGCTGCCCGCGGTGATCGGAATGGAGGCCATGGTCCAGGTC
GGCTCAGCCGTCACCGGCCGGCGGGACGTGCCGGTCATCGAGGACGCCCGGTTCCTGCGG
CCGATCGTGGTGCCACCCGGCGGCACGACCCGCATCCGGATCGCGGCCACCGTCACCGGC
ACCGACCGTGTGGACGTGGCCGTCCACGCGCAGGACACCGGTTTCGCGGCGGAGCACTTC
CGGGCGCGGCTGGTCTACGGCGGCGCGGCGATCCCGGACGGCGCCCCCGACCAGGTGGGG
CCGAAGGTGCCGACGGCTCCGCTGGACCCCGCGACCGACCTGTACGGCGGGGTGCTCTTC
CAGGGCGAGCGTTTCCAGCGGCTGCGGCGCTTCCACCGGGCCGCCGCCCGGCACGTCGAC
GCCGAGGTGGCGCTCGACACGGCGTCCGGCTGGTTCGCCGGCTTCCTGCCGGGCACGCTG
CTGCTCTCGGACCCGGGGATGCGCGACGCCCTGATGCACGGAAACCAGGTGTGCGTCCCC
GACGCGACCCTGCTGCCGTCCGGCATCGAGCGGCTGTATCCGATGGCGGCCGGCGAGGAT
CTCCCGGAGCTGGTCCGCTACTGCGCGACCGAGCGCCACCGGGACGGCGACACCTATGTG
TACGACATCGCCGTGCGGACTCCCGACGGCTCCGTCGTCGAGCGGTGGGACGGGCTCACC
CTTCATGCCGTGCGCAAGTCGGACGGCTCCGGCCCATGGGTCGCACCGCTGCTCGGCTCC
TATCTCGAAAGAACCCTGGAGGAAGTGCTCGGCACCCATGTCGACGTCGCCGTGGAGCCG
GTCCCAGCAGACTCCGGGGGCTCCGTGGCCGATCGCCGCAAGGCCACCGCACGGGCCGTC
CAGCGGGCGCTCGGTGAGAGTGTAAAGGTGCGCTACCGGCCCGACGGGCGGCCCGAACTC
GACGGCGTGCGCCGCCTGTCGGCAGCACACGGCCCGGGGGTGACGCTGGGCGTCGTCGGC
ACCACCACGGTGGCCTGCGACATCGAGGCGGTCACCGCTCGCGGTGCGCAGGAGTGGGAG
GGACTGCTCGGCGAGCACGGGAACCTGGCGGCCCTGGTCGCCAAGGAGACCGGGGAGACG
CCGGACCACGCGGCGACCCGCGTGTGGACGGCCGTCGAGTGCCTGAAGAAGGCCGGCCTT
CCGGCCGGGGCGCCTCTCACCCTGGAGCCTCAGGTCAGAAGCGGGTGGATCGTCCTGACG
GCGGGCGGGCTGCGCATCGCGACCTTCGCCACCACGCTGCGGCACGTCGAAGAGCCCGTG
GTGCTCGCGTTCCTCACCGCCGGCACGGACGATGCGGCCCCCGGGAGCGCCCGCGCGTGA
[1] KS2..411
[1] AT619..847
[1] acetyl-CoA malonyl-CoA757..761
[1] ACP929..1021
[1] KR1203..1383
[1] DH1453..1608
[1] PPT1710..1923
[1] KS4..1233
[1] AT1855..2541
[1] acetyl-CoA malonyl-CoA2269..2283
[1] ACP2785..3063
[1] KR3607..4149
[1] DH4357..4824
[1] PPT5128..5769

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [583-688]  4.2e-40 G3DSA:3.40.366.10 [756-853]  4.2e-40 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [934-1032]  2.19999900980708e-07 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1203-1383]  1.2e-29 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-288]  2.50000000000001e-53 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-411]  3.8e-28 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [619-847]  1.1e-28 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [583-865]  3.89999861795218e-42 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [693-756]  6.80000200614766e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [2-125]  6.6999999999999e-61 G3DSA:3.40.47.10 [158-300]  6.6999999999999e-61 G3DSA:3.40.47.10 [301-462]  4.70000000000003e-41 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-295]  1.99999636034521e-61 SSF53901 [255-468]  5.09998762524166e-51 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1202-1426]  1.3e-25 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit