close all open/close all

CDS information : C1027_00530


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction71,703 / 70,573 / - [in whole cluster]
71,703 / 70,573 / - [in contig]
Locationcomplement(70573..71703) [in whole cluster]
complement(70573..71703) [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenesgcE5
unbU
Gene (GenBank)
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
  • ORF47
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTVPGSKTLTPAPRHDVKVTTALRRFAISISILNIAGYTFLGFEQPWLWPFIAVLTAYAV
EIVLEAVSARGEKRAPRFAGGGFKGMVEFLFPAHITGLAVNMLTYVNDRVWVMVFGVIVA
VGTKWVLRAPLKGRMRHYMNPSNFGIAMILVLFPWASIAPPYHFTEYLYGPADWVLPAII
LVLGTMLNAKLTGRMWLIMAWLGGFVVQAVVRGLVTGTSIPAALGMMTGVAFVLFTNYMV
TDPGTSPSKRSSQIFFGAGVAAMYGVLTALGIAYGIFFATALVCLIRGGYLWGLHFLAKQ
REAQAPPALGVQGHRPDTAVEQMTAAPAPAAASGPADGSPEPATVVLSGNPCKDGTCFHG
KCAAERASKKKATVPV
selected fasta
>hypothetical protein [unknown]
GTGACCGTGCCCGGTTCAAAGACGCTCACGCCCGCCCCCCGGCACGATGTGAAGGTCACC
ACCGCCCTCCGCCGGTTCGCGATCTCGATCTCGATCCTCAACATCGCCGGGTACACCTTC
CTCGGCTTCGAACAGCCATGGCTGTGGCCCTTCATCGCGGTCCTCACCGCCTATGCGGTG
GAGATCGTCCTGGAGGCCGTCAGCGCCCGCGGCGAGAAGCGGGCGCCCCGCTTCGCCGGC
GGGGGGTTCAAGGGGATGGTCGAATTCCTCTTCCCCGCCCACATCACGGGCCTCGCCGTG
AACATGCTGACCTACGTCAACGACCGCGTGTGGGTCATGGTCTTCGGCGTCATCGTGGCC
GTCGGCACCAAGTGGGTGCTGCGGGCTCCGCTCAAGGGCCGCATGCGGCACTACATGAAC
CCGTCGAACTTCGGGATCGCAATGATCCTGGTCCTCTTCCCGTGGGCGAGCATCGCGCCG
CCCTACCACTTCACCGAGTACCTGTACGGCCCGGCGGACTGGGTGCTCCCCGCGATCATC
CTGGTCCTGGGCACCATGCTCAACGCCAAGCTGACCGGACGCATGTGGCTGATCATGGCC
TGGCTCGGCGGCTTCGTGGTGCAGGCCGTCGTCCGAGGGCTGGTCACGGGCACATCCATC
CCCGCGGCACTCGGCATGATGACCGGCGTCGCCTTCGTGCTCTTCACCAACTACATGGTC
ACCGACCCCGGCACCTCACCCTCCAAGCGATCCTCCCAGATCTTCTTCGGAGCCGGAGTC
GCGGCGATGTACGGCGTGCTGACCGCTCTCGGAATCGCGTACGGCATCTTCTTCGCGACC
GCCTTGGTCTGCCTGATCCGCGGGGGCTACCTGTGGGGGCTGCACTTCCTCGCCAAGCAG
CGTGAGGCTCAGGCGCCTCCCGCCCTCGGGGTCCAGGGCCACCGCCCCGACACCGCGGTC
GAGCAGATGACGGCCGCCCCGGCGCCCGCCGCCGCTTCCGGACCGGCGGACGGATCGCCC
GAGCCGGCGACGGTCGTCCTCTCGGGCAACCCCTGTAAGGACGGCACCTGCTTCCACGGC
AAGTGCGCAGCCGAACGAGCGTCGAAGAAAAAGGCGACGGTGCCTGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [21-43]  Transmembrane (i-o) [47-69]  Transmembrane (o-i) [78-100]  Transmembrane (i-o) [110-127]  Transmembrane (o-i) [140-159]  Transmembrane (i-o) [174-191]  Transmembrane (o-i) [196-215]  Transmembrane (i-o) [219-241]  Transmembrane (o-i) [254-276]  Transmembrane (i-o)
Transmembrane 9