close all open/close all

CDS information : C1027_00540


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction73,628 / 71,700 / - [in whole cluster]
73,628 / 71,700 / - [in contig]
Locationcomplement(71700..73628) [in whole cluster]
complement(71700..73628) [in contig]
TypeCDS
Length1,929 bp (642 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenesgcE4
unbV
Gene (GenBank)
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
  • ORF48
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HJ0
NITE
Dynm_00160
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTHPISWLRKQAPGVVALAVMVGTFYAVKPSESSAAEKKEMAESFTFEPMAISMPGGYKK
QSVRKVNKAYKHIEAWISSVGAGVAMNDIDGDGLPNDLCITDPQIDQTVVTPAPAPGRES
PTYAPFVLDPAPLPKSDIMAPIGCVPGDFNEDGAMDLLVYYWGRTPVIFQAERKPGEDTT
AMDPKSFKPVELVPGSNGSTYKGPLWNSNAATVADFDGDGHNDIYIGNYFPDSPVLDDSV
HGGVTMNDSLSHAQNGGGGHFFRWTPSGFEEVKNVLPKGIDRGWTLAVSATDLDGDQRPE
MYLAHDFGTSALLYNRSTPGTFKFSEVKAVHTATTPKSKEIGRSSFKGMGVDFGDLDNDG
LYDAFVSNITTSFGIQESNFAFVATARDKADLRAKFRDGVAPYKDESAPLNLAWSGWGWD
VKMGDFDNNGIQEITQAVGFVKGKRNRWAQLQELATANDALVKHPRFWPRVEEGDDLAGD
QHLRFFVQDKDGEAYSDLSKQLGLAVPVPSRGIATGDADGDGRLDMVVARQWEDPVFYCN
MSKDTGEYLNLSLVDEAGSPVIGAQVTVTLSDGSTRLGRVDGGSGHSGKRSQDVHIGLGQ
EADGPMETRLTWRDRTGQVRNKDLQLTPGRHALELGADVKEK
selected fasta
>hypothetical protein [unknown]
ATGACACATCCAATTTCGTGGCTGCGGAAGCAGGCTCCGGGGGTCGTCGCACTCGCTGTC
ATGGTCGGCACTTTCTACGCGGTGAAGCCGTCGGAGTCGAGCGCCGCCGAGAAAAAGGAA
ATGGCGGAGAGTTTCACTTTCGAGCCGATGGCGATATCCATGCCTGGCGGTTACAAGAAA
CAGAGCGTCCGCAAGGTCAACAAGGCCTACAAGCACATCGAGGCGTGGATCTCCTCCGTC
GGCGCCGGCGTCGCCATGAACGACATCGACGGCGACGGCCTGCCCAACGACCTCTGCATC
ACCGATCCGCAGATCGACCAGACCGTCGTCACCCCGGCCCCGGCGCCCGGTCGCGAGAGT
CCCACGTACGCCCCCTTCGTGCTCGACCCGGCTCCGCTGCCCAAGAGCGACATCATGGCG
CCGATCGGCTGCGTCCCCGGGGACTTCAACGAGGACGGCGCGATGGACCTGCTCGTCTAC
TACTGGGGCCGCACCCCGGTGATCTTCCAGGCGGAGAGGAAGCCGGGCGAGGACACCACG
GCGATGGACCCGAAGTCCTTCAAGCCCGTCGAACTGGTTCCCGGCAGCAACGGCAGCACC
TACAAGGGCCCCCTGTGGAACTCCAACGCCGCGACGGTCGCCGACTTCGACGGCGACGGT
CACAATGACATCTACATCGGGAACTACTTCCCCGACAGCCCCGTCCTGGACGACAGCGTG
CACGGCGGCGTGACGATGAACGACTCGCTCTCCCACGCCCAGAACGGCGGCGGCGGTCAC
TTCTTCCGCTGGACCCCCTCCGGCTTCGAGGAGGTCAAGAACGTCCTGCCGAAGGGCATC
GACCGGGGCTGGACACTTGCCGTCTCCGCCACCGACCTGGACGGCGACCAGCGCCCCGAG
ATGTACCTGGCGCACGACTTCGGAACCTCGGCGCTGCTGTACAACAGGTCGACCCCCGGA
ACGTTCAAGTTCAGCGAGGTGAAGGCCGTACACACCGCGACCACTCCGAAGTCCAAGGAG
ATCGGCCGCAGCTCCTTCAAGGGCATGGGCGTCGACTTCGGTGATCTGGACAACGACGGC
CTGTACGACGCCTTCGTCTCCAACATCACCACCTCCTTCGGCATCCAGGAGTCGAACTTC
GCCTTCGTCGCGACCGCTCGCGACAAGGCGGATCTGCGGGCGAAGTTCCGTGACGGCGTC
GCCCCCTACAAGGACGAGAGCGCACCTCTCAACCTCGCCTGGTCCGGTTGGGGCTGGGAC
GTGAAGATGGGGGACTTCGACAACAACGGAATCCAGGAGATCACCCAGGCGGTCGGCTTC
GTCAAGGGCAAGCGCAACCGCTGGGCCCAGCTCCAGGAGCTCGCCACCGCCAACGACGCG
CTGGTCAAGCACCCCCGCTTCTGGCCCCGGGTGGAGGAGGGCGACGACCTCGCCGGCGAT
CAGCACCTGCGCTTCTTCGTACAGGACAAGGACGGCGAGGCCTACAGCGACCTGTCCAAG
CAGCTCGGTCTGGCTGTACCCGTGCCCAGCCGGGGCATCGCCACCGGCGACGCCGACGGG
GACGGCCGCCTGGACATGGTGGTCGCCCGCCAGTGGGAGGACCCGGTCTTCTACTGCAAC
ATGAGCAAGGACACCGGGGAATACCTCAACCTCAGCCTCGTCGACGAGGCCGGATCGCCC
GTGATCGGCGCGCAGGTCACCGTGACCCTGTCCGACGGCAGCACCCGCCTGGGCCGCGTC
GACGGCGGCAGCGGCCACTCCGGCAAGCGCAGCCAGGACGTGCACATCGGACTCGGCCAG
GAGGCCGACGGCCCGATGGAGACCCGTCTGACCTGGCGCGACCGCACCGGTCAGGTGCGC
AACAAGGACCTCCAGCTGACTCCCGGCAGGCACGCGCTGGAACTCGGCGCCGACGTGAAG
GAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011519 ASPIC/UnbV (Domain)
 [560-633]  1.69999999999999e-17 PF07593
PF07593   UnbV_ASPIC
SignalP
 [1-35]  0.503 Signal
Bacteria, Gram-positive   
TMHMM No significant hit