close all open/close all

CDS information : C1027_00560


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction75,688 / 74,942 / - [in whole cluster]
75,688 / 74,942 / - [in contig]
Locationcomplement(74942..75688) [in whole cluster]
complement(74942..75688) [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GenesgcE2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF50
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q8GMD8
NITE
C1027_00550
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
ACC
Q84HJ1
NITE
Dynm_00150
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MASVPGSLRRLLMAPSLADVSFAGRGFPVVETAATRQLETIPQTVVTGFEWGIESKSLWE
TERRLSLVDEELRGFAYEGATMASVIRDSMPGRGGRTAELLQGAGRRHIFLNYIGIGFAM
AKLPRPLWKKAVPALDGDDLYPSMSWLAVDGYGFDRAYFAPERWVDEQRLDTPYGWEDRP
GYFQRAGGPGHRASPVVHPRRRGGCRVRRGQPVRLRSQAGPVGRCRARGHVRRLLHRGGA
GHASRPVG
selected fasta
>hypothetical protein [hypothetical protein]
GTGGCATCGGTACCGGGATCCCTGCGCAGACTTCTCATGGCTCCGTCCCTGGCCGACGTG
AGCTTCGCGGGCCGGGGTTTCCCGGTGGTCGAGACCGCCGCGACCCGCCAGCTGGAGACC
ATCCCCCAGACGGTGGTCACCGGATTCGAGTGGGGCATCGAGTCGAAGAGCCTGTGGGAG
ACCGAGCGGCGGCTCTCCCTGGTCGACGAGGAGCTGCGGGGCTTCGCCTACGAGGGCGCG
ACCATGGCTTCGGTGATCCGGGACTCGATGCCCGGACGGGGAGGCCGCACCGCGGAACTG
CTCCAGGGAGCCGGACGCCGCCACATCTTCCTCAACTACATCGGCATCGGTTTCGCGATG
GCCAAGCTGCCCAGGCCGCTGTGGAAGAAGGCCGTGCCCGCGCTCGACGGCGACGACCTC
TACCCGTCGATGAGCTGGCTCGCGGTCGACGGCTACGGCTTCGACCGCGCCTACTTCGCC
CCGGAGCGATGGGTGGACGAGCAGCGGCTGGACACCCCGTACGGCTGGGAGGACCGGCCC
GGCTACTTCCAGCGGGCGGGTGGACCAGGGCATCGGGCGAGCCCTGTGGTTCATCCACGG
CGCCGCGGTGGATGCCGTGTGCGCCGCGGTCAACCGGTTCGCCTCCGATCGCAGGCCGGA
CCTGTGGGCCGGTGTCGGGCTCGCGGCCACGTTCGCCGGCTGCTCCACCGCGGCGGAGCT
GGACACGCTTCGCGTCCGGTCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012964 Protein of unknown function DUF1702 (Family)
 [5-186]  1.6e-61 PF08012
PF08012   DUF1702
SignalP No significant hit
TMHMM No significant hit