close all open/close all

CDS information : C1027_00580


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction76,421 / 77,026 / + [in whole cluster]
76,421 / 77,026 / + [in contig]
Location76421..77026 [in whole cluster]
76421..77026 [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GenesgcS
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF52
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTHCPSQTDRGGPGMAISTGASPFTVRGGIEAVNTRHHQLGLRVFMFIVVAHWAEHLVQA
YQIYVMGWPIPEARGVLGMPFPWLVTSEWMHYGYALVMMVGLFLLRPGFTGRSATWWKIS
LGIQVWHHMEHLLLLVQALAGANLLGRPAATSLIQLIAPRVELHLFYNTLVTVPMVVAMY
LHTRPGRPDNADARCTCAPKA
selected fasta
>hypothetical protein [hypothetical protein]
ATGACCCACTGCCCCTCCCAAACCGACCGTGGAGGCCCAGGGATGGCCATCAGCACCGGA
GCATCACCTTTCACCGTTCGCGGCGGGATCGAAGCCGTCAACACCCGCCACCACCAACTC
GGCCTGCGTGTGTTCATGTTCATCGTCGTCGCGCACTGGGCTGAGCACCTGGTCCAGGCC
TACCAGATCTACGTCATGGGCTGGCCCATTCCGGAGGCGCGCGGCGTCCTCGGGATGCCG
TTCCCCTGGCTGGTCACCTCGGAGTGGATGCACTACGGCTACGCCCTGGTGATGATGGTC
GGCCTGTTCCTCCTGCGGCCGGGGTTCACCGGGCGCTCGGCCACCTGGTGGAAGATCTCC
CTCGGCATCCAGGTCTGGCACCACATGGAACATCTGCTGCTCCTGGTGCAGGCACTGGCC
GGGGCCAACCTGCTGGGGAGGCCGGCGGCAACCAGTCTGATCCAGCTGATAGCGCCCCGC
GTGGAGCTGCACCTCTTCTACAACACCCTGGTGACGGTTCCCATGGTGGTCGCGATGTAC
CTGCACACCCGGCCCGGCCGACCGGACAACGCCGACGCACGGTGCACCTGCGCCCCGAAG
GCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [41-63]  Transmembrane (i-o) [83-105]  Transmembrane (o-i)
Transmembrane 2