close all open/close all

CDS information : C1027_00590


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction77,031 / 77,492 / + [in whole cluster]
77,031 / 77,492 / + [in contig]
Location77031..77492 [in whole cluster]
77031..77492 [in contig]
TypeCDS
Length462 bp (153 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GenesgcT
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF53
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTTSGRRPSGFVSLLLLLLGVLLFWLTVPNLGDAARTATADGPLGTFTATRLVCAGHAGH
TTCEWLGTFRSTDGTVDLGSVKLYGSDRDAFEAGRTAPAVDVGNPGRVYDPAGSYTWIVT
VGLAVLSYALLITVARRHLGPPPRAAGVLPAAS
selected fasta
>hypothetical protein [hypothetical protein]
GTGACGACGAGCGGCAGAAGGCCTTCGGGGTTCGTGTCCTTGCTGCTCCTGCTTCTCGGA
GTCCTGCTGTTCTGGCTGACGGTGCCGAACCTGGGTGACGCGGCCCGGACCGCCACGGCG
GACGGGCCCCTGGGCACCTTCACCGCTACCCGCCTGGTGTGCGCCGGGCACGCCGGACAC
ACCACCTGCGAGTGGCTGGGGACGTTCCGCTCCACCGACGGCACCGTGGATCTCGGGAGC
GTCAAGCTGTACGGAAGCGACCGCGACGCCTTCGAAGCCGGCCGGACCGCTCCGGCCGTG
GACGTGGGCAACCCCGGGCGGGTCTACGATCCGGCCGGTTCGTACACCTGGATCGTCACG
GTCGGGCTGGCCGTTCTCTCCTACGCCCTGCTCATCACGGTCGCCCGCCGCCACCTCGGG
CCTCCCCCGCGGGCGGCGGGCGTCCTGCCGGCGGCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-34]  0.854 Signal
Eukaryota   
 [1-34]  0.475 Signal
Bacteria, Gram-positive   
TMHMM
 [9-28]  Transmembrane (i-o) [113-135]  Transmembrane (o-i)
Transmembrane 2