close all open/close all

CDS information : C1027_00600


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction78,769 / 77,582 / - [in whole cluster]
78,769 / 77,582 / - [in contig]
Locationcomplement(77582..78769) [in whole cluster]
complement(77582..78769) [in contig]
TypeCDS
Length1,188 bp (395 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)TylR regulatory protein-like protein
GenesgcR3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF54
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)

close this sectionSequence

selected fasta
>transcriptional activator [TylR regulatory protein-like protein]
MAAHDVRHAHLPVSVLADQIFGHLPRADQRAWAQAYLTGLLTTDGKKSIRRMAATVSRSP
TASQSMHQFLNASPWDWAPARAELMRWVEQQLDPRAWVLSVAVLRKRGDHSCGVHRRFVP
ATGRSVNCQLAVGAFLSTGATAVPVHWGLLLPGAWVEDHARRARARIPESVGQRSVEQHA
LDLVDALCGSTQLSPRPVVADLSHHSGVISLVRGLTARGREFVVSLPGRTPVVPVGRTTA
RGAYSANLPAPVEAQRLFGLKHAGHLRPGAHDGHGGADRTATMTTLVRLPQVRLARHTPH
ATYRIFGMPSYSGPRSARIWLTNMTQRRTDELLALAGLQHRAGTAVQSLEDDFGLLDFEG
RSFPGWHHHMTLVSAASAYNLLELSGRRPGSQEGS
selected fasta
>transcriptional activator [TylR regulatory protein-like protein]
ATGGCGGCACACGACGTGAGGCACGCGCACCTGCCGGTCTCCGTACTTGCCGATCAGATC
TTCGGGCACCTGCCGAGGGCCGATCAGAGGGCGTGGGCCCAGGCCTACCTGACGGGGCTG
CTGACCACCGACGGCAAGAAGTCGATCAGACGGATGGCCGCCACCGTCTCCCGTTCGCCC
ACCGCGTCGCAGTCGATGCACCAGTTCCTCAATGCCAGCCCCTGGGACTGGGCCCCGGCA
CGTGCCGAGCTGATGAGATGGGTCGAGCAGCAGCTCGATCCGCGCGCCTGGGTCCTGTCG
GTGGCGGTGTTACGCAAGCGGGGAGATCACTCCTGCGGGGTGCACCGGCGCTTCGTCCCC
GCCACCGGACGCTCCGTCAACTGCCAGCTCGCGGTGGGTGCGTTCCTCTCCACCGGCGCG
ACGGCCGTGCCCGTCCACTGGGGGCTCCTGCTGCCCGGGGCCTGGGTCGAGGACCATGCG
CGCCGCGCACGGGCCCGCATCCCCGAATCGGTCGGCCAGCGCAGCGTCGAGCAGCATGCG
CTGGACCTCGTCGACGCGCTGTGCGGGAGCACGCAACTGAGTCCCCGGCCGGTGGTGGCC
GATCTGAGTCATCATTCCGGGGTCATCTCGCTGGTGCGCGGACTCACCGCCAGGGGACGC
GAGTTCGTCGTGTCACTGCCGGGCCGGACCCCGGTGGTCCCGGTGGGGAGAACGACGGCG
CGCGGCGCGTACTCCGCGAACCTGCCCGCCCCCGTGGAGGCACAGCGCCTCTTCGGCCTC
AAGCACGCCGGGCATCTCAGACCCGGCGCCCATGATGGGCACGGCGGCGCCGATCGCACC
GCCACGATGACCACGCTGGTGCGGCTGCCGCAGGTGCGGCTGGCACGTCACACGCCGCAC
GCCACGTACCGGATCTTCGGTATGCCGTCCTACTCGGGGCCCCGCTCCGCGCGGATCTGG
CTGACCAACATGACGCAGCGGCGGACCGACGAACTGCTGGCGCTGGCCGGGCTCCAGCAC
CGGGCGGGCACCGCGGTGCAGTCGCTGGAGGACGACTTCGGTCTGCTCGACTTCGAGGGA
CGGTCCTTTCCCGGCTGGCATCACCACATGACTCTCGTGTCGGCGGCTTCGGCGTACAAC
CTGCTGGAGCTGTCCGGCCGCCGGCCCGGCTCCCAGGAGGGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit