close all open/close all

CDS information : C1027_00610


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction80,060 / 81,484 / + [in whole cluster]
80,060 / 81,484 / + [in contig]
Location80060..81484 [in whole cluster]
80060..81484 [in contig]
TypeCDS
Length1,425 bp (474 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative primase/helicase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF55
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [putative primase/helicase]
MDEAGSAGHFRSNAVPATPVGPRGTSSELSPAARPLGLPERRRTYSAPARRRRLRTVRST
PSVLGVGLLPDSLTDRGNAKLFVRLYAQDYRHVTGLGWYRWDGTRWQSDEDDTVLWVAGE
MAESIAATDPRGVYSDAALRKHRRRALSTSGINALLSQARSAPGMVLSAGALDADPYMLC
TPAGVVDLRSGKLRAADPDRDFHSRSTSIGPRQMPTPRWDLFLTDTFGDDARGREMIRFL
HLLLGYSLTGDVGAQVMPFLFGSGKNGKSVLLDVLIKLLGDYADAAPPGFLMARPFEGHP
TDLAELHGRRVIVCSEVKPGDRFDESRVKLLTGGDRIKARRMRQDFFSFAPTHKLWLLGN
HRPEVGTGGYAFWRRMRLIPFDRVVSDQQKIDNLADILVTEEGPGILNWLITGAHHYLNS
PRDLTGPETVRIATTAYAETEDHTGRFLTEHGTTSRSGRTRHRGTESSGGTTSG
selected fasta
>hypothetical protein [putative primase/helicase]
GTGGACGAGGCCGGCTCTGCAGGTCATTTTCGCTCGAACGCTGTGCCCGCCACACCGGTC
GGCCCCCGCGGAACCTCCTCGGAACTGTCACCCGCCGCCCGCCCCCTCGGCCTTCCCGAG
CGCCGGCGCACCTACTCGGCCCCGGCGCGCCGCAGACGCCTGCGGACCGTGCGCAGCACC
CCCTCGGTGTTGGGGGTGGGGTTGTTACCGGATTCGTTGACGGATCGGGGGAACGCGAAG
CTGTTCGTGCGGTTGTACGCGCAGGACTACCGGCATGTGACGGGGCTGGGGTGGTACCGG
TGGGACGGCACGCGGTGGCAGAGCGATGAGGACGACACGGTGCTGTGGGTCGCTGGTGAG
ATGGCGGAGAGTATCGCGGCGACCGATCCGCGGGGGGTGTATTCCGATGCGGCGCTGCGC
AAGCACCGGCGGCGTGCGTTGAGCACGTCGGGGATCAACGCGTTGTTGAGCCAGGCGAGA
TCGGCGCCGGGGATGGTGCTCAGTGCGGGGGCGCTGGACGCGGATCCGTACATGCTGTGC
ACGCCGGCGGGGGTGGTGGACCTGCGGTCGGGGAAGCTGCGGGCCGCGGACCCGGACCGG
GACTTCCATTCGCGCTCGACCTCGATCGGCCCCCGGCAGATGCCGACGCCGCGCTGGGAT
CTCTTCCTGACCGATACCTTCGGGGACGACGCGCGGGGCCGGGAGATGATCCGTTTCCTG
CATCTCCTGCTCGGTTACTCCCTCACCGGTGACGTCGGAGCGCAGGTCATGCCGTTCCTG
TTCGGATCGGGCAAGAACGGAAAGTCCGTACTGCTCGACGTCCTGATCAAGCTGCTGGGC
GACTACGCGGACGCCGCGCCGCCCGGTTTCCTGATGGCCCGTCCCTTCGAGGGGCACCCC
ACCGACCTCGCCGAACTCCACGGACGCCGCGTGATCGTGTGTTCCGAGGTCAAGCCCGGT
GACCGGTTCGACGAGTCCCGGGTGAAACTCCTGACCGGCGGCGACCGCATCAAAGCACGC
CGGATGCGCCAGGACTTCTTCTCCTTCGCCCCCACCCACAAACTCTGGCTCCTGGGCAAC
CACCGCCCCGAAGTCGGCACCGGCGGCTACGCCTTCTGGCGCCGGATGCGCCTGATCCCC
TTCGACCGCGTCGTCTCCGACCAGCAGAAAATCGACAACCTCGCCGACATCCTCGTCACC
GAGGAAGGCCCCGGCATCCTCAACTGGCTCATCACCGGAGCCCACCACTACCTCAACAGC
CCCCGCGACCTCACCGGACCGGAAACCGTCCGCATCGCCACCACCGCCTACGCCGAAACC
GAAGACCACACCGGCCGCTTCCTCACCGAACACGGGACGACCTCCCGGTCAGGGCGGACA
CGTCACCGCGGAACGGAATCGTCCGGGGGAACGACATCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006500 DNA primase, phage/plasmid (Domain)
 [177-456]  9.80000000000012e-77 TIGR01613
TIGR01613   Primase_Cterm
IPR014015 Helicase, superfamily 3, DNA virus (Domain)
 [235-394]  PS51206
PS51206   SF3_HELICASE_1
IPR014818 Bacteriophage/plasmid primase, P4, C-terminal (Domain)
 [79-228]  1e-24 SM00885
SM00885   D5_N
 [79-227]  5.40000000000002e-29 PF08706
PF08706   D5_N
SignalP No significant hit
TMHMM No significant hit