close all open/close all

CDS information : C1027_00630


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction82,351 / 81,881 / - [in whole cluster]
82,351 / 81,881 / - [in contig]
Locationcomplement(81881..82351) [in whole cluster]
complement(81881..82351) [in contig]
TypeCDS
Length471 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF57
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPLLRCDLSRGGEPCCGRHHRVSGTGKGRDGGGSVGPSAAVPLRSIGGVPAVAPVFPLSA
FCAGGRSAARMTSSSTRLTAVSAGTLIAAGIFTFLYRDVRTGLTRAGRHLLASDRSVGRV
RPVSPPAGAGSHTPPRADAVSDFRLLMAAGPVHSVQ
selected fasta
>hypothetical protein [hypothetical protein]
GTGCCGCTTCTACGCTGTGACCTCAGCCGTGGAGGGGAACCCTGTTGTGGCCGGCATCAC
CGAGTCAGCGGCACGGGAAAGGGGAGGGATGGCGGCGGGAGCGTCGGTCCGTCGGCGGCA
GTTCCTCTGCGGTCGATCGGCGGCGTGCCGGCCGTGGCGCCGGTGTTCCCGCTGTCGGCC
TTCTGCGCGGGCGGTCGGTCCGCGGCCCGGATGACGTCATCCTCCACACGATTGACGGCG
GTCTCCGCGGGGACCCTGATCGCGGCGGGCATCTTCACCTTCTTGTACCGGGACGTCAGG
ACTGGACTCACGCGCGCCGGGAGGCATCTCCTGGCATCCGATCGCTCCGTGGGACGCGTG
AGGCCTGTTTCACCGCCGGCGGGCGCAGGATCCCATACCCCGCCCCGGGCTGATGCGGTA
TCCGACTTTAGGCTGCTCATGGCCGCAGGCCCGGTGCACAGTGTCCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit