close all open/close all

CDS information : C1027_00640


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction82,408 / 83,091 / + [in whole cluster]
82,408 / 83,091 / + [in contig]
Location82408..83091 [in whole cluster]
82408..83091 [in contig]
TypeCDS
Length684 bp (227 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF58
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPHRTRAHKRTEEVEHARLPREHEGRFVPPHPRSTVPHIEISNDHPGIRGLMFQRPDAAA
PLNHLANVLLRAPASLSRGERELIAAYVSHLNDTPFCAGTHGAAAAAQLDGGHEAVTAVF
AAPQDAPVSPRMRALLAVAAEVMAAARPVGDETVAAARAAGAEDSDIHDTVLIAAAFCMY
NRYVSCLATGIPTQDDYYQQAADRIVTDGYATASGQNGTRADEALTG
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCGCACAGGACCCGGGCACACAAGCGCACGGAGGAAGTTGAGCACGCTCGCCTCCCC
CGTGAACATGAAGGCCGCTTCGTCCCTCCGCATCCGAGGAGCACTGTGCCGCACATCGAG
ATCAGCAACGACCACCCCGGCATCCGGGGCTTGATGTTCCAGCGGCCGGACGCCGCCGCG
CCGCTCAACCACCTCGCCAACGTCCTGCTGCGCGCCCCGGCGTCCTTGAGCCGGGGCGAA
CGGGAACTGATCGCCGCCTACGTCTCACACCTGAACGACACCCCGTTCTGCGCCGGAACC
CACGGAGCCGCGGCAGCAGCACAGCTGGACGGCGGACACGAGGCGGTGACCGCCGTCTTC
GCCGCTCCGCAGGACGCACCCGTCTCCCCCCGGATGCGCGCCCTGCTCGCCGTCGCCGCC
GAGGTCATGGCAGCTGCGCGTCCCGTCGGCGACGAGACGGTAGCGGCTGCCCGCGCCGCG
GGTGCCGAGGACAGCGACATCCACGACACCGTGCTGATCGCCGCCGCCTTCTGCATGTAC
AACCGCTATGTCAGCTGCCTGGCGACCGGCATCCCGACGCAGGACGACTACTACCAGCAG
GCTGCGGACCGCATCGTCACCGACGGCTATGCCACGGCGAGCGGACAGAACGGCACCCGG
GCCGACGAGGCTCTCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [56-141]  1.3e-09 PF02627
PF02627   CMD
IPR010195 Uncharacterised peroxidase-related (Family)
 [54-187]  2.2e-24 TIGR01926
TIGR01926   Peroxid_rel
SignalP No significant hit
TMHMM No significant hit