close all open/close all

CDS information : C1027_00650


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction83,513 / 83,115 / - [in whole cluster]
83,513 / 83,115 / - [in contig]
Locationcomplement(83115..83513) [in whole cluster]
complement(83115..83513) [in contig]
TypeCDS
Length399 bp (132 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF59; similar to the sequence deposited in AF12795
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSALIDGDEISEEAELVWLEDISILDYVRQSLDRLPNRRGRPAYHRDGRMVGYAVLHARA
RPSRTSGTFRRRVFWLLPHDRDTAPQGLYATGAPAEAVDPATLTPRTKGQKTERSEGGPL
TTPPHPATPVPG
selected fasta
>hypothetical protein [unknown]
GTGAGTGCTCTGATCGACGGGGACGAGATCAGTGAGGAAGCGGAGCTTGTCTGGCTGGAG
GACATCTCGATCCTGGATTACGTACGACAGAGCCTGGACCGGCTCCCCAACCGGAGAGGA
AGGCCCGCCTACCACCGGGACGGCCGCATGGTGGGATACGCCGTGCTCCATGCGCGGGCC
CGCCCCTCACGTACGTCCGGCACCTTCCGCCGACGCGTCTTCTGGCTCCTGCCCCACGAC
CGCGACACCGCCCCCCAGGGCCTCTACGCCACCGGCGCACCGGCCGAAGCCGTCGACCCC
GCCACCCTCACCCCCCGCACCAAAGGCCAGAAGACCGAACGATCCGAAGGAGGCCCCCTC
ACCACCCCCCCTCACCCGGCCACACCTGTGCCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit