close all open/close all
C1027_00650 C1027_00650   last last

CDS information : C1027_00660


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction85,045 / 83,510 / - [in whole cluster]
85,045 / 83,510 / - [in contig]
Locationcomplement(83510..85045) [in whole cluster]
complement(83510..85045) [in contig]
TypeCDS
Length1,536 bp (511 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative primase/helicase-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF60
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [putative primase/helicase-like protein]
MTPGGRPPSGFDAHAVAAQILARSTSAGPSLPAGGVPGRAEASAGPEQVLGVGLLPDSLT
DRGNAKLFVRLYAQDYRHVTGLGWYRWDGTRWQSDEDDTVLWVAGEMAESIAATDPRGVY
SDAALRKHRRRALSTSGINALLSQARSAPGMVLSAGALDADPYMLCTPAGVVDLRSGKLR
AADPDRDFHSRSTSIGPRQMPTPRWDLFLTDTFGDDARGREMIRFLHLLLGYSLTGDVGA
QVMPFLFGSGKNGKSVLLDVLIKLLGDYADAAPPGFLMARPFEGHPTDLAELHGRRVIVC
SEVKPGDRFDESRVKLLTGGDRIKARRMRQDFFSFAPTHKLWLLGNHRPEVGTGGYAFWR
RMRLIPFDRVVSDQQKIDNLADILVTEEGPGILNWLITGAHHYLNSPRDLTGPETVRIAT
TAYAETEDHTGRFLTERCTFQPHHRVEQARLYHAYTAWSRHEGINPASSRAFAARIREAV
GLASPKEMLLSNQRKYYPGIGLLAVAEEEAE
selected fasta
>hypothetical protein [putative primase/helicase-like protein]
ATGACCCCCGGAGGCCGTCCGCCGTCCGGCTTCGACGCTCACGCCGTGGCAGCCCAGATC
CTCGCACGGTCCACTTCTGCCGGGCCTTCGCTGCCCGCGGGAGGGGTTCCGGGTCGTGCA
GAGGCGTCTGCGGGCCCGGAGCAGGTGTTGGGGGTGGGGTTGTTACCGGATTCGTTGACG
GATCGGGGGAACGCGAAGCTGTTCGTGCGGTTGTACGCGCAGGACTACCGGCATGTGACG
GGGCTGGGGTGGTACCGGTGGGACGGCACGCGGTGGCAGAGCGATGAGGACGACACGGTG
CTGTGGGTCGCTGGTGAGATGGCGGAGAGTATCGCGGCGACCGATCCGCGGGGGGTGTAT
TCCGATGCGGCGCTGCGCAAGCACCGGCGGCGTGCGTTGAGCACGTCGGGGATCAACGCG
TTGTTGAGCCAGGCGAGATCGGCGCCGGGGATGGTGCTCAGTGCGGGGGCGCTGGACGCG
GATCCGTACATGCTGTGCACGCCGGCGGGGGTGGTGGACCTGCGGTCGGGGAAGCTGCGG
GCCGCGGACCCGGACCGGGACTTCCATTCGCGCTCGACCTCGATCGGCCCCCGGCAGATG
CCGACGCCGCGCTGGGATCTCTTCCTGACCGATACCTTCGGGGACGACGCGCGGGGCCGG
GAGATGATCCGTTTCCTGCATCTCCTGCTCGGTTACTCCCTCACCGGTGACGTCGGAGCG
CAGGTCATGCCGTTCCTGTTCGGATCGGGCAAGAACGGAAAGTCCGTACTGCTCGACGTC
CTGATCAAGCTGCTGGGCGACTACGCGGACGCCGCGCCGCCCGGTTTCCTGATGGCCCGT
CCCTTCGAGGGGCACCCCACCGACCTCGCCGAACTCCACGGACGCCGCGTGATCGTGTGT
TCCGAGGTCAAGCCCGGTGACCGGTTCGACGAGTCCCGGGTGAAACTCCTGACCGGCGGC
GACCGCATCAAAGCACGCCGGATGCGCCAGGACTTCTTCTCCTTCGCCCCCACCCACAAA
CTCTGGCTCCTGGGCAACCACCGCCCCGAAGTCGGCACCGGCGGCTACGCCTTCTGGCGC
CGGATGCGCCTGATCCCCTTCGACCGCGTCGTCTCCGACCAGCAGAAAATCGACAACCTC
GCCGACATCCTCGTCACCGAGGAAGGCCCCGGCATCCTCAACTGGCTCATCACCGGAGCC
CACCACTACCTCAACAGCCCCCGCGACCTCACCGGACCGGAAACCGTCCGCATCGCCACC
ACCGCCTACGCCGAAACCGAAGACCACACCGGCCGCTTCCTCACCGAACGCTGCACCTTC
CAGCCCCACCACAGAGTCGAACAGGCCCGCCTGTACCACGCCTACACGGCCTGGTCCCGG
CACGAGGGCATCAATCCCGCCTCGTCCCGGGCCTTCGCCGCCCGCATCCGGGAAGCCGTC
GGACTGGCGTCACCGAAGGAGATGCTGCTGTCGAACCAGCGCAAGTACTACCCGGGCATC
GGGCTCCTGGCTGTGGCCGAGGAGGAGGCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006500 DNA primase, phage/plasmid (Domain)
 [163-472]  2.39999999999997e-85 TIGR01613
TIGR01613   Primase_Cterm
IPR014015 Helicase, superfamily 3, DNA virus (Domain)
 [221-380]  PS51206
PS51206   SF3_HELICASE_1
IPR014818 Bacteriophage/plasmid primase, P4, C-terminal (Domain)
 [65-213]  6.3e-29 PF08706
PF08706   D5_N
 [65-214]  1e-24 SM00885
SM00885   D5_N
SignalP No significant hit
TMHMM No significant hit
C1027_00650 C1027_00650   last last