close all open/close all
first first   Calm_00020 Calm_00020

CDS information : Calm_00010


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction1 / 873 / + [in whole cluster]
1 / 873 / + [in contig]
Location1..873 [in whole cluster]
1..873 [in contig]
TypeCDS
Length873 bp (290 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU1
Gene
Gene (GenBank)calU1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU1]
MTLPDDPSAVAWRLEVEDFDADPEEFAGLVQAMREQVPADAVHALVVGEWGEAYERPLPV
ELLVAAAREWTALRAVFLADLTYEQCEISWLRHGDVTPLLAAYPALEVLWVRGAQDLRLE
PVRHDRLRELRFESGGLPAGVVRAVGACELPALHRLELWLGRSDYGGDATVDDLVGVLAG
TGLPALRHLAPCNAEIADAVAAAVAAAPVVPRLEVLDLSMGTLTDEGAKALLAGQPLTHL
TRLDLHHHYLSEEMAAAVVAALPGVRVDVSDPQTADEYDGTRYRYTEVGE
selected fasta
>hypothetical protein [CalU1]
ATGACCCTCCCCGACGATCCGTCGGCGGTCGCCTGGCGGCTGGAGGTCGAGGACTTCGAC
GCCGATCCCGAGGAGTTCGCCGGCCTCGTGCAGGCCATGCGTGAGCAGGTGCCGGCCGAC
GCGGTGCACGCCCTGGTGGTCGGCGAGTGGGGCGAGGCGTACGAGCGACCGCTGCCGGTG
GAGCTGCTGGTGGCGGCGGCTCGCGAGTGGACGGCGCTGCGGGCGGTCTTTCTCGCCGAC
CTGACCTACGAGCAGTGCGAGATCTCCTGGCTCCGGCACGGCGACGTCACCCCGCTGCTC
GCGGCGTACCCGGCGCTGGAGGTGCTGTGGGTGCGCGGCGCGCAGGACCTGCGGCTGGAA
CCGGTCCGGCACGACCGGCTGCGCGAGCTGCGATTCGAGTCCGGCGGGCTGCCGGCCGGT
GTGGTGCGGGCCGTCGGCGCCTGCGAGCTGCCGGCCCTGCACCGGCTGGAGCTGTGGCTC
GGCCGCTCCGACTACGGCGGCGACGCGACCGTGGACGACCTGGTCGGCGTGCTGGCCGGC
ACCGGCCTGCCCGCGCTGCGGCACCTGGCGCCGTGCAACGCCGAGATCGCCGACGCGGTG
GCGGCGGCCGTCGCCGCGGCGCCGGTCGTCCCGCGGCTGGAGGTCCTCGACCTGTCGATG
GGCACGCTCACCGACGAGGGCGCGAAGGCGCTGCTGGCCGGCCAGCCGCTGACCCATCTG
ACGCGGCTCGACCTGCACCACCACTACCTCTCCGAGGAGATGGCCGCGGCGGTGGTCGCC
GCGCTGCCGGGGGTGCGGGTCGACGTGTCCGACCCGCAGACCGCCGACGAGTACGACGGC
ACCCGCTACCGCTACACCGAGGTCGGGGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Calm_00020 Calm_00020