close all open/close all

CDS information : Calm_00030


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction1,874 / 2,935 / + [in whole cluster]
1,874 / 2,935 / + [in contig]
Location1874..2935 [in whole cluster]
1874..2935 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU3
Gene
Gene (GenBank)calU3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU3]
MFTRAVLDAGLPRPAVLPWADVLTGAAPPAPDALVRVDSPGEDPEVDRLLRRSAAPARHG
ELVGLADTYAGLLRGLDRVAAGGAELLNDPEDVAVMCDKRRCHARLSAAGVPVPAALPPV
GGWAELRAAMAAAGWSRVFVKPAHGSSAAGVIALAVAGRRVQAVTTVEATPEGLFNSLRP
RRYTDEAQVAAIVDRLAPESLHVERWLPKAGLGDRVVDLRVVVVAGRPTHAVVRAARGPL
TNLHLGNARGDLAALRAAAGPAAWAAAMETCERVAGCFPRTLQVGIDLMFLVGWRRHAVA
EVNAFGDLLPGVLTDGRDTYAEQVQAVTDGRWERWRAAAGRALDEREVLPCGA
selected fasta
>hypothetical protein [CalU3]
ATGTTCACCCGGGCGGTCCTCGATGCCGGCCTGCCCCGGCCCGCGGTGCTGCCCTGGGCC
GACGTGCTGACCGGGGCGGCCCCGCCGGCGCCGGACGCGCTGGTGCGGGTCGACTCGCCC
GGGGAGGACCCGGAGGTGGACCGGCTGCTGCGCCGGTCCGCCGCCCCGGCCCGGCACGGC
GAGCTGGTCGGCCTGGCCGACACGTACGCCGGCCTGCTCAGGGGCCTGGACCGGGTCGCC
GCCGGCGGCGCGGAGCTGCTCAACGACCCGGAGGACGTCGCGGTCATGTGCGACAAGCGG
CGCTGCCACGCGCGGCTGTCCGCCGCCGGGGTGCCGGTGCCCGCCGCGCTGCCCCCCGTG
GGCGGCTGGGCGGAGCTGCGGGCGGCGATGGCGGCGGCCGGCTGGAGCCGGGTGTTCGTC
AAGCCCGCGCACGGCTCGTCCGCCGCCGGGGTGATCGCGCTGGCGGTCGCCGGGCGCCGG
GTGCAGGCGGTCACCACGGTCGAGGCGACCCCCGAGGGGCTGTTCAACTCGTTGCGGCCG
CGCCGCTACACCGACGAGGCGCAGGTCGCCGCGATCGTCGACCGGCTCGCGCCCGAGAGC
CTGCACGTGGAGCGGTGGCTGCCCAAGGCGGGGCTCGGCGACCGGGTGGTCGACCTGCGG
GTGGTGGTGGTCGCCGGGCGGCCCACCCACGCCGTGGTGCGGGCCGCGCGAGGGCCACTG
ACCAACCTGCACCTGGGCAACGCCCGCGGCGACCTCGCCGCGCTGCGGGCGGCCGCCGGG
CCGGCGGCGTGGGCGGCGGCGATGGAGACCTGCGAGCGGGTCGCCGGGTGTTTTCCCCGC
ACCCTCCAGGTGGGGATCGACCTGATGTTCCTCGTCGGCTGGCGGCGGCACGCGGTGGCG
GAGGTCAACGCGTTCGGCGACCTGCTGCCGGGGGTGCTGACCGACGGCCGGGACACCTAC
GCCGAGCAGGTGCAGGCAGTGACCGACGGCCGGTGGGAACGCTGGCGGGCGGCGGCCGGT
CGCGCCCTCGACGAGCGGGAGGTGCTGCCGTGCGGAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [90-153]  4.29999999999999e-05 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
SignalP No significant hit
TMHMM No significant hit