close all open/close all

CDS information : Calm_00040


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction2,932 / 3,726 / + [in whole cluster]
2,932 / 3,726 / + [in contig]
Location2932..3726 [in whole cluster]
2932..3726 [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU4
Gene
Gene (GenBank)calU4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU4]
MIGSHDLLLLTLDTLRYDVAAELAERGRTPHLARALPGGRWERRHSPASFTYAAHHAFFA
GFLPTPVTPGRHERLYAAAFPGSETAGRDTWVFDAPDLPTALAGVGYHTLCLGGVGFFNR
RSPLGAVLPGLFAEAHWEPEFGVTSPTCLDAQLDRLAEVLPRVPAGRPLFTFLNVAALHQ
PNRHHLPGAQADDLASHAAALEYVDGRIDRLFTLLTGRGRPVFAIVCADHGTAYGEDGHT
GHRIGHDVVWTVPYAHFTLHPGEW
selected fasta
>hypothetical protein [CalU4]
CTGATCGGCAGCCACGACCTGCTCCTGCTCACCCTCGACACGCTCCGCTACGACGTCGCC
GCCGAGCTGGCGGAGCGGGGGCGCACGCCGCACCTGGCCCGGGCGCTGCCCGGCGGGCGG
TGGGAGCGCCGGCACTCCCCCGCCAGCTTCACCTACGCCGCGCACCACGCGTTCTTCGCC
GGCTTCCTGCCGACCCCGGTGACCCCCGGCCGGCACGAGCGGCTGTACGCGGCGGCCTTC
CCCGGCAGCGAGACCGCCGGCAGGGACACGTGGGTCTTCGACGCGCCGGACCTGCCGACC
GCCCTGGCCGGCGTCGGCTACCACACGCTCTGCCTGGGCGGGGTCGGCTTCTTCAACCGG
CGCAGCCCGCTCGGCGCGGTGCTGCCGGGCCTGTTCGCCGAGGCGCACTGGGAGCCGGAG
TTCGGGGTCACCTCCCCCACCTGCCTGGACGCCCAGCTCGACCGGCTGGCCGAGGTGCTG
CCACGGGTGCCGGCGGGGCGACCGCTGTTCACGTTCCTCAACGTCGCGGCGCTGCACCAG
CCCAACCGGCACCACCTGCCCGGCGCGCAGGCCGACGACCTCGCCAGCCACGCCGCCGCC
CTGGAGTACGTCGACGGCCGGATCGACCGGTTGTTCACCCTGCTCACCGGCCGGGGCCGG
CCGGTGTTCGCGATCGTCTGCGCCGACCACGGCACCGCGTACGGCGAGGACGGCCACACC
GGCCACCGGATCGGTCACGACGTGGTGTGGACCGTCCCGTACGCCCACTTCACTCTGCAC
CCGGGAGAATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000917 Sulfatase (Domain)
 [7-246]  2.7e-10 PF00884
PF00884   Sulfatase
IPR017849 Alkaline phosphatase-like, alpha/beta/alpha (Domain)
 [7-247]  4.80000000000001e-14 G3DSA:3.40.720.10
G3DSA:3.40.720.10   Alk_phosphtse
IPR017850 Alkaline-phosphatase-like, core domain (Domain)
 [3-253]  8.90000829418053e-17 SSF53649
SSF53649   Alkaline_phosphatase_core
SignalP No significant hit
TMHMM No significant hit