close all open/close all

CDS information : Calm_00050


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction3,723 / 5,048 / + [in whole cluster]
3,723 / 5,048 / + [in contig]
Location3723..5048 [in whole cluster]
3723..5048 [in contig]
TypeCDS
Length1,326 bp (441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalE1
Gene
Gene (GenBank)calE1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalE1]
MTSTDTGLGGSPYQQYLYAYPHKTSYRPLRPRPLLADVWRAEARDALFLYVHVPFCEMRC
GFCNLFTRANAPAEQVTGYLRQLRRQAEQVADALGADAGYARAAFGGGTPTYLTADELAE
LFDIATTTTGARLPGVPLSVETSPATATPDRLAVLAAHGTTRVSIGVQSFLDAEARAAGR
PQRRTEVEAALGAIRDARIPVLNIDLIYGIDGQTADTWRESLDAALAWRPEELYLYPLYV
RPLTGLGRRAHHRAEWDAQRLALYEQAVEALDAAGYRQESMRQFRRADVPPPDGPDYCCQ
DDGMVGLGCGARSYTTSLHYSFDYAVSVTEVRAVLDDYLARPADDFRHAEFGFTLDGAEQ
RRRWLLKSLLRVDGVDPAAYRARFGRPPGDDFPELGRLVDRGWATDGGLRLTPAGLARSD
AVGPWLTSARVRDAMTGYVPR
selected fasta
>hypothetical protein [CalE1]
GTGACCAGCACCGACACGGGCCTCGGCGGCTCGCCGTACCAGCAGTACCTGTACGCGTAC
CCGCACAAGACCTCGTACCGGCCGTTGCGGCCCCGGCCGTTGCTGGCGGACGTGTGGCGG
GCCGAGGCGCGCGACGCGCTCTTCCTCTACGTGCATGTGCCGTTCTGCGAGATGCGCTGC
GGCTTCTGCAACCTGTTCACCCGCGCCAACGCCCCCGCCGAGCAGGTGACCGGCTACCTG
CGGCAGCTGCGCCGGCAGGCCGAACAGGTCGCCGACGCGCTCGGCGCCGACGCCGGGTAC
GCCCGCGCGGCGTTCGGCGGCGGCACCCCCACCTACCTGACCGCCGACGAGCTGGCCGAG
CTGTTCGACATCGCCACCACCACGACGGGGGCGCGGCTGCCCGGCGTACCGCTGTCGGTG
GAGACCTCGCCGGCCACCGCGACGCCGGACCGGCTCGCGGTGCTCGCCGCGCACGGCACC
ACCCGGGTGAGCATCGGCGTGCAGAGCTTCCTCGACGCCGAGGCCCGCGCCGCCGGCCGG
CCGCAGCGCCGCACCGAGGTGGAGGCGGCCCTCGGTGCGATCCGCGACGCCCGCATCCCC
GTACTCAACATCGACCTGATCTACGGCATCGACGGGCAGACCGCCGACACCTGGCGGGAG
AGCCTCGACGCGGCGCTGGCCTGGCGCCCGGAGGAGCTGTACCTCTACCCGCTGTACGTG
CGGCCGCTGACCGGGCTCGGGCGGCGGGCGCACCACCGGGCGGAGTGGGACGCCCAGCGG
CTCGCCCTCTACGAGCAGGCGGTGGAGGCGCTGGACGCGGCCGGGTACCGGCAGGAGTCG
ATGCGGCAGTTCCGCCGGGCCGACGTGCCGCCGCCGGACGGGCCGGACTACTGCTGCCAG
GACGACGGCATGGTCGGGCTGGGCTGCGGCGCCCGCTCGTACACCACGAGCCTGCACTAC
TCGTTCGACTACGCGGTCAGCGTGACCGAGGTGCGGGCGGTGCTCGACGACTACCTGGCC
CGCCCGGCCGACGACTTCCGGCACGCCGAGTTCGGGTTCACCCTCGACGGCGCCGAGCAG
CGCCGCCGGTGGCTGCTCAAGTCGCTGCTGCGCGTCGACGGCGTCGACCCGGCGGCGTAC
CGGGCCCGGTTCGGCCGCCCGCCCGGCGACGACTTCCCGGAGCTGGGCCGGCTGGTCGAC
CGGGGCTGGGCCACCGACGGCGGGCTGCGGCTGACGCCGGCCGGGCTGGCCCGCTCCGAC
GCGGTCGGCCCGTGGCTGACCTCGGCCCGGGTCCGCGACGCGATGACCGGGTACGTGCCC
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006638 Elongator protein 3/MiaB/NifB (Domain)
 [46-266]  1.3000049540733e-36 SM00729
SM00729   Elp3
IPR007197 Radical SAM (Domain)
 [51-223]  9.50000000000001e-17 PF04055
PF04055   Radical_SAM
IPR010723 HemN, C-terminal domain (Domain)
 [355-416]  1.1e-09 PF06969
PF06969   HemN_C
IPR023404 Radical SAM, alpha/beta horseshoe (Domain)
 [48-273]  7.79999999999999e-25 G3DSA:3.80.30.20
G3DSA:3.80.30.20   G3DSA:3.80.30.20
SignalP No significant hit
TMHMM No significant hit