close all open/close all

CDS information : Calm_00080


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction8,285 / 7,665 / - [in whole cluster]
8,285 / 7,665 / - [in contig]
Locationcomplement(7665..8285) [in whole cluster]
complement(7665..8285) [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)CalR1
Gene
Gene (GenBank)calR1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
P39885
PmId
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [CalR1]
MHTGETESAPGRRDRRKRRTRAALTGAALRLVAERGLAQVTVEEISEAAGVSPRTFFNYF
ACKDDALVGDHAGDAARLVARLAAVPPEVPVLTALRAALDEVIDEVRTERELWCLRMEVV
TRNPVLLPRLVAGNVETERAIAEVVAARVGVDPDHGYPALVTAVAGAAVRTAMTRWAAHP
DGPDLADLVDEAFAALAAGLPQPDPT
selected fasta
>putative TetR family transcriptional regulator [CalR1]
GTGCACACCGGCGAGACCGAATCCGCCCCCGGGCGACGCGACCGCAGGAAGCGCCGGACC
CGGGCCGCGCTGACCGGGGCGGCGCTGCGCCTGGTGGCTGAGCGCGGCCTGGCCCAGGTG
ACGGTGGAGGAGATCAGCGAGGCGGCCGGCGTCTCCCCGCGTACCTTCTTCAACTACTTC
GCCTGCAAGGACGACGCGCTGGTCGGCGACCACGCGGGCGACGCGGCGCGGCTGGTCGCG
CGCCTGGCGGCCGTGCCGCCGGAGGTGCCGGTGCTGACCGCGCTGCGGGCCGCGCTCGAC
GAGGTGATCGACGAGGTGCGCACCGAGCGCGAGCTGTGGTGCCTGCGGATGGAGGTGGTG
ACGCGCAACCCGGTGTTGCTGCCCCGTCTGGTCGCCGGCAACGTCGAGACCGAGCGGGCC
ATCGCCGAGGTCGTCGCGGCGCGGGTCGGGGTCGATCCCGACCACGGCTACCCGGCACTC
GTCACCGCCGTGGCCGGGGCGGCGGTGCGAACCGCGATGACCCGGTGGGCCGCACATCCC
GACGGACCGGACCTGGCCGACCTCGTCGACGAGGCGTTCGCCGCGCTCGCCGCGGGTCTG
CCGCAGCCCGACCCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [26-65]  1.1e-11 PF00440
PF00440   TetR_N
 [18-78]  PS50977
PS50977   HTH_TETR_2
 [24-37]  1.19999985703101e-05 PR00455 [45-68]  1.19999985703101e-05 PR00455
PR00455   HTHTETR
IPR009057 Homeodomain-like (Domain)
 [12-64]  1.99999999999999e-17 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [13-88]  6.49999377884395e-15 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [65-201]  1.70000000000001e-39 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit