close all open/close all

CDS information : Calm_00100


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction9,987 / 9,415 / - [in whole cluster]
9,987 / 9,415 / - [in contig]
Locationcomplement(9415..9987) [in whole cluster]
complement(9415..9987) [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose epimerase
Product (GenBank)CalS1
Gene
Gene (GenBank)calS1
EC number5.1.3.-
Keyword
  • 3-methoxy-L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[24911465] A general NMR-based strategy for the in situ characterization of sugar-nucleotide-dependent biosynthetic pathways. (Org Lett. , 2014)
Related Reference
ACC
Q9L9E5
PmId
[16514445] Characterisation of Streptomyces spheroides NovW and revision of its functional assignment to a dTDP-6-deoxy-D-xylo-4-hexulose 3-epimerase. (Chem Commun (Camb). , 2006)
ACC
Q93EK2
PmId
[11544225] Rhamnose biosynthesis pathway supplies precursors for primary and secondary metabolism in Saccharopolyspora spinosa. (J Bacteriol. , 2001)
ACC
Q5SFD1
NITE
Chalc_00130
PmId
[23116432] Structural and functional studies on a 3'-epimerase involved in the biosynthesis of dTDP-6-deoxy-D-allose. (Biochemistry. , 2012)
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>NDP-hexose epimerase [CalS1]
MDIRALTIEGSWLVTPEQHHDDRGLFLEWYQADRFTEAVGRPFRVAQSNVSVSGRGVIRG
IHLVDVPPGQDKYITCVSGAVLDVVVDLRVGSPTFGRWEGVRLDDVDRRAVHLDAGLGHA
FCALTEPATVVYLCSSPYDPAAERTVNPLDPELGIAWPAGPRRLSPRDATAQNVAQALAG
GVLPTYVPRG
selected fasta
>NDP-hexose epimerase [CalS1]
GTGGACATCCGGGCGTTGACGATCGAGGGTTCGTGGCTGGTCACCCCGGAGCAGCACCAC
GACGACCGGGGCCTGTTCCTGGAGTGGTACCAGGCGGACCGCTTCACCGAGGCGGTCGGA
CGGCCGTTCCGCGTGGCGCAGTCCAATGTCTCCGTCTCGGGCCGGGGGGTGATCCGAGGC
ATCCATCTGGTGGACGTGCCACCCGGCCAGGACAAGTACATCACCTGCGTCTCCGGGGCG
GTGCTCGACGTCGTGGTGGACCTGCGGGTGGGCTCGCCGACCTTCGGCCGGTGGGAGGGG
GTGCGGCTGGACGACGTCGACCGCCGCGCCGTCCACCTCGACGCCGGGCTCGGCCACGCG
TTCTGCGCGCTGACCGAGCCGGCCACCGTCGTGTACCTCTGCTCGTCGCCGTACGACCCG
GCGGCCGAACGCACCGTCAACCCCCTCGACCCGGAGCTCGGGATCGCCTGGCCGGCGGGG
CCGCGCCGGCTGTCGCCCCGCGACGCCACCGCCCAGAACGTGGCGCAGGCCCTTGCCGGG
GGCGTGCTCCCGACCTACGTGCCGCGCGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [4-176]  7.59999999999998e-58 PF00908
PF00908   dTDP_sugar_isom
 [1-179]  PD001462
PD001462   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-181]  1.50000965748778e-66 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-184]  8.39999999999997e-63 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit