close all open/close all

CDS information : Calm_00110


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction10,158 / 11,081 / + [in whole cluster]
10,158 / 11,081 / + [in contig]
Location10158..11081 [in whole cluster]
10158..11081 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 ketoreductase
Product (GenBank)CalS2
Gene
Gene (GenBank)calS2
EC number
Keyword
  • 3-methoxy-L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[24911465] A general NMR-based strategy for the in situ characterization of sugar-nucleotide-dependent biosynthetic pathways. (Org Lett. , 2014)
Related Reference
ACC
Q9L9E9
PmId
[15752721] Functional characterizations of novWUS involved in novobiocin biosynthesis from Streptomyces spheroides. (Arch Biochem Biophys. , 2005)
ACC
Q93F84
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>NDP-hexose C-4 ketoreductase [CalS2]
MSVPTPRLLVTGAGGLLGRELGELLAGSGDRHTTLDRSALDITDAAAVRHAVPGHDVVVN
AAAWTDVDGAESDEAGATEVNGAGPANLARACARTGALLIHLSSDYVFSGETTVPWPEDA
PPAPLNAYGRSKLAGERAVRGLLPAGGYVVRTGWLYGRHGPNFVRAVLRRAAETEFVDVV
DDQHGQPTWARALAGRLVALAGLAAAGRAPAGIYHGTAAGRTTWYGFARTVFALHGLDPD
RVRPTGSGTLAARPARRPRISVLGHDGWARAGLGPLPPWRRMIEAAVAEERSRAGPAGQD
RTRRRSA
selected fasta
>NDP-hexose C-4 ketoreductase [CalS2]
ATGAGCGTGCCGACGCCACGGTTGCTGGTGACCGGCGCGGGCGGGTTGCTGGGCCGCGAG
TTGGGCGAGCTCCTCGCCGGCAGCGGCGACCGGCACACCACCCTCGACCGGTCCGCGCTC
GACATCACCGACGCCGCCGCGGTGCGGCACGCCGTGCCCGGCCACGACGTCGTCGTCAAC
GCCGCCGCCTGGACCGACGTCGACGGGGCCGAGTCGGACGAGGCCGGCGCCACCGAAGTG
AACGGCGCCGGCCCGGCCAACCTGGCCCGGGCGTGTGCGAGGACCGGGGCGCTCCTGATC
CACCTGTCCAGCGACTACGTCTTCTCCGGCGAGACCACGGTGCCGTGGCCGGAGGACGCC
CCGCCGGCCCCGTTGAACGCGTACGGCCGTAGCAAGCTCGCCGGCGAGCGGGCCGTGCGC
GGCCTGCTGCCCGCCGGGGGCTACGTGGTCCGGACCGGGTGGCTGTACGGCCGGCACGGC
CCGAACTTCGTCCGCGCGGTGCTGCGCCGGGCCGCCGAGACGGAGTTCGTGGACGTCGTG
GACGACCAGCACGGCCAGCCCACCTGGGCGCGCGCGCTCGCCGGCCGGCTGGTCGCGCTG
GCCGGGCTGGCCGCCGCCGGGCGGGCGCCGGCCGGGATCTACCACGGCACGGCGGCCGGT
CGGACCACCTGGTACGGCTTCGCCCGCACGGTCTTCGCGCTGCACGGGCTCGACCCGGAC
CGCGTGCGCCCGACGGGCAGCGGGACGCTGGCCGCCCGGCCCGCCCGGCGGCCACGGATC
TCCGTCCTCGGGCACGACGGGTGGGCGCGGGCCGGCCTCGGCCCGCTGCCGCCGTGGCGA
CGGATGATCGAGGCGGCCGTGGCCGAGGAGCGGAGCCGGGCCGGGCCGGCCGGCCAGGAC
CGCACGCGACGGAGGTCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005913 dTDP-4-dehydrorhamnose reductase (Family)
 [7-288]  9.80000000000012e-80 TIGR01214
TIGR01214   RmlD
 [7-289]  2.09999999999996e-94 PF04321
PF04321   RmlD_sub_bind
IPR016040 NAD(P)-binding domain (Domain)
 [7-236]  1.99999999999999e-56 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit