close all open/close all

CDS information : Calm_00120


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction11,078 / 12,109 / + [in whole cluster]
11,078 / 12,109 / + [in contig]
Location11078..12109 [in whole cluster]
11078..12109 [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-glucose 4,6-dehydratase
Product (GenBank)CalS3
Gene
Gene (GenBank)calS3
EC number4.2.1.46
Keyword
  • 3-methoxy-L-rhamnose
  • 4-hydroxyamino-6-deoxy-alpha-D-glucose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[24911465] A general NMR-based strategy for the in situ characterization of sugar-nucleotide-dependent biosynthetic pathways. (Org Lett. , 2014)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>dTDP-glucose 4,6-dehydratase [CalS3]
MNTTRILVTGGAGFIGSHYVRTLLRPAGPGGVRITVLDKLTYAGNLANLRPVAGHPAYRF
VRGDICDSLLVDRLVAEHDQVVHFAAESHVDRSIADGGDFVRTNTLGTYTLLEAVRRRHG
DRAVFVHVSTDEVYGSIEHGTWPETDPVLPSSPYAAAKAASDLLALAFVRTHGLDVRVTR
CANNYGPHQHPEKLVPLAITNLLDGGDVPLYGDGLHVRDWLHVDDHVRALELVRTRGRAG
QVYNVGGGTQLTNREMADRLLAACGAGPERIRYVEDRKGHDRRYAVDWSKIRCELGYAPR
KDLDRGLADTVAWYRANRSWWEPLRRRPVAQAGRPTGTDHGLA
selected fasta
>dTDP-glucose 4,6-dehydratase [CalS3]
ATGAACACGACGCGGATCCTCGTCACCGGCGGCGCCGGCTTCATCGGGTCGCACTACGTC
CGCACCCTGCTGCGGCCGGCGGGACCGGGCGGCGTCCGGATCACCGTGCTGGACAAGCTG
ACGTACGCGGGCAACCTCGCCAACCTGCGTCCCGTCGCCGGCCACCCCGCCTACCGTTTC
GTCCGCGGCGACATCTGCGACAGCCTCCTGGTGGACCGGCTGGTGGCGGAGCACGACCAG
GTCGTGCACTTCGCCGCCGAGTCCCACGTGGACCGGTCCATCGCCGACGGCGGCGACTTC
GTCCGCACCAACACGCTCGGCACCTACACCCTGCTGGAGGCGGTCCGGCGGCGGCACGGC
GACCGCGCGGTCTTCGTGCACGTCTCCACCGACGAGGTGTACGGGTCGATCGAGCACGGC
ACCTGGCCGGAGACGGACCCGGTCCTGCCCAGTTCGCCGTACGCCGCCGCGAAGGCCGCC
AGCGACCTGCTCGCCCTGGCCTTCGTCCGGACGCACGGGCTCGACGTGCGGGTGACGCGG
TGCGCCAACAACTACGGCCCGCACCAGCACCCGGAGAAGCTGGTGCCGCTGGCGATCACG
AACCTGCTCGACGGCGGGGACGTCCCGCTCTACGGCGACGGGCTGCACGTGCGCGACTGG
CTGCACGTCGACGACCACGTCCGGGCGCTGGAGCTGGTGCGGACGCGGGGCCGGGCCGGG
CAGGTCTACAACGTCGGCGGGGGCACCCAGTTGACCAACCGGGAGATGGCCGATCGCCTG
CTTGCGGCCTGCGGCGCCGGGCCCGAACGGATCCGCTACGTCGAGGACCGCAAGGGGCAC
GACCGGCGCTACGCGGTCGACTGGAGCAAGATCAGATGCGAGCTCGGGTACGCGCCGCGC
AAGGACCTCGACCGCGGGCTCGCCGACACGGTCGCCTGGTATCGCGCGAACCGCTCCTGG
TGGGAGCCGCTTCGGCGACGCCCTGTTGCGCAAGCTGGGAGACCGACCGGGACGGACCAC
GGGTTAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-246]  1.29999999999998e-63 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [5-324]  1.99999999999999e-130 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [2-193]  3.80000000000003e-63 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit