close all open/close all

CDS information : Calm_00150


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction14,103 / 15,017 / + [in whole cluster]
14,103 / 15,017 / + [in contig]
Location14103..15017 [in whole cluster]
14103..15017 [in contig]
TypeCDS
Length915 bp (304 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative homocysteine S-methyltransferase
Product (GenBank)CalE2
GenecalE2
mmuM
Gene (GenBank)calE2
EC number2.1.1.10
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
Q47690
PmId
[9882684] S-methylmethionine metabolism in Escherichia coli. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative homocysteine S-methyltransferase [CalE2]
MDVPGAPTAGPLVLDGGLGTELQRHGRSVSAPWWTARCLLDAGGRRLVSRVHAAYVAAGA
DVLTADTFRTTLRTAYRAGTDEATAAGLVRTAVTLARRAADSTGAGRRVLVAASVAPVED
CYRPDLVPGAAVLRREHGWLADQLARAGVDLALVETMNTVREAVVATRAVREHGLPAWVS
FVCTGDARLLSGEDLAAAADAVRAAGAAAVLVNCTDPAGTERALRRLRAAGPGLLGAYPN
VEDRSGVPPATPVDRYLPPGLTPDAFADLWAAWRPVGLRIVGGCCGTTPAHIAALRSRLA
PRPG
selected fasta
>putative homocysteine S-methyltransferase [CalE2]
GTGGACGTACCGGGGGCGCCGACGGCCGGGCCACTGGTCCTCGACGGCGGGCTGGGCACC
GAGCTGCAACGGCACGGCCGGTCCGTGTCCGCCCCGTGGTGGACGGCACGCTGCCTGCTG
GACGCCGGGGGCCGGCGCCTCGTCTCCCGCGTCCACGCCGCGTACGTGGCGGCGGGAGCG
GACGTGCTCACCGCGGACACGTTCCGCACCACCCTGCGGACGGCGTACCGGGCCGGAACG
GACGAGGCCACGGCCGCCGGTCTGGTCCGTACCGCCGTGACGCTGGCCCGCCGCGCGGCC
GATTCGACGGGGGCCGGCCGGCGGGTGCTCGTCGCCGCCTCCGTCGCCCCGGTCGAGGAC
TGCTACCGGCCGGACCTGGTGCCCGGCGCCGCGGTGCTGCGGCGGGAGCACGGCTGGCTG
GCCGACCAGCTTGCCCGCGCCGGCGTCGACCTGGCGCTGGTCGAGACCATGAACACCGTC
CGGGAGGCGGTCGTCGCCACCCGGGCGGTACGCGAACACGGCCTGCCGGCCTGGGTGAGC
TTCGTCTGCACCGGCGACGCCCGCCTGCTGTCCGGTGAGGACCTCGCCGCGGCGGCCGAC
GCGGTACGGGCGGCCGGCGCGGCTGCGGTCCTGGTCAACTGCACCGACCCGGCGGGCACC
GAACGCGCGCTGCGGCGGCTCCGCGCCGCCGGGCCGGGCCTGCTCGGCGCGTACCCGAAC
GTGGAGGACCGCAGCGGCGTGCCGCCGGCCACCCCGGTGGACCGCTATCTCCCGCCCGGC
CTGACGCCCGACGCCTTCGCCGACCTCTGGGCGGCCTGGCGCCCCGTCGGGCTGCGCATC
GTCGGCGGTTGCTGCGGCACCACCCCGGCGCACATCGCCGCGTTGCGGTCCCGCCTGGCG
CCGCGCCCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003726 Homocysteine S-methyltransferase (Domain)
 [10-302]  1.20000000000001e-77 G3DSA:3.20.20.330
G3DSA:3.20.20.330   S_methyl_trans
 [12-299]  1.5e-46 PF02574
PF02574   S-methyl_trans
 [1-299]  PS50970
PS50970   HCY
 [9-302]  4.69998262513189e-74 SSF82282
SSF82282   S_methyl_trans
SignalP No significant hit
TMHMM No significant hit