close all open/close all

CDS information : Calm_00160


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction16,092 / 15,028 / - [in whole cluster]
16,092 / 15,028 / - [in contig]
Locationcomplement(15028..16092) [in whole cluster]
complement(15028..16092) [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative adenosine deaminase
Product (GenBank)CalS5
Gene
Gene (GenBank)calS5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
P22333
PmId
[1998686] Deduced amino acid sequence of Escherichia coli adenosine deaminase reveals evolutionarily conserved amino acid residues: implications for catalytic function. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative adenosine deaminase [CalS5]
MTTAVPAGQDLTDVLGRLPKVELHVHLEGSVRPGTLLRIARRHGLDLGRLDEAAVVELFR
FRDFRHFTELYEQCCGALRDPADLELITEELADEAHRQNVRHLEVTFSPGTHRRGAGIPF
DEQLDAVARGAEQARRRTGVTMRFVVDHVRGGPPEECQQVAEWAVAGAGRGVVALGLGGF
EPRRPASLFGEAVRWAAARGVPFVPHAGEAVGPEGVWDCLPFRPPRIGHGIRSVEDPRLV
AALRDRAVVLEVCPTSNLRTGVVSEPGAHPLRRLWDAGVRLTLNTDDPSMFHTDLLAEHR
FAVEWHGFTVAELAAMTLIGVDAALLPATEREALRERVTTELAELGVTAAGLPA
selected fasta
>putative adenosine deaminase [CalS5]
GTGACGACCGCCGTACCAGCCGGGCAGGATCTCACCGACGTCCTTGGCCGCCTGCCCAAG
GTCGAGTTGCACGTGCACCTCGAAGGGTCGGTGCGGCCCGGCACCCTGCTCCGGATCGCC
CGCCGGCACGGCCTCGACCTTGGTCGGCTCGACGAGGCGGCGGTGGTGGAACTCTTCCGC
TTCCGCGACTTCCGCCACTTCACAGAACTGTACGAACAGTGCTGCGGGGCGCTGCGCGAC
CCGGCCGACCTCGAACTGATCACCGAGGAACTCGCCGACGAGGCGCACCGGCAGAACGTC
CGCCACCTGGAGGTGACGTTCAGCCCCGGCACGCACCGGCGGGGAGCGGGCATCCCGTTC
GACGAGCAGCTCGACGCCGTGGCCCGGGGCGCCGAGCAGGCCCGCCGCCGCACCGGCGTC
ACGATGCGCTTCGTCGTCGACCACGTCCGGGGCGGGCCGCCGGAGGAGTGCCAGCAGGTC
GCCGAGTGGGCGGTCGCCGGCGCCGGCCGGGGCGTGGTGGCGCTCGGTCTCGGCGGTTTC
GAGCCGCGGCGCCCGGCCTCGCTGTTCGGGGAGGCCGTCCGGTGGGCGGCGGCGCGGGGC
GTGCCGTTCGTGCCGCACGCGGGCGAGGCGGTCGGGCCCGAGGGCGTCTGGGACTGCCTG
CCGTTCCGCCCGCCGCGCATCGGGCACGGCATCCGCTCCGTCGAGGACCCGCGGCTGGTG
GCGGCGTTGCGGGACCGGGCCGTGGTCCTCGAGGTCTGCCCCACCAGCAACCTGCGTACG
GGCGTGGTCTCCGAGCCGGGGGCGCACCCGCTGCGCCGGTTGTGGGACGCCGGGGTGCGG
CTCACCCTCAACACCGACGACCCCAGCATGTTCCACACCGACCTGCTCGCCGAGCACCGG
TTCGCTGTCGAGTGGCACGGTTTCACCGTGGCCGAACTCGCCGCCATGACGCTGATCGGG
GTCGACGCCGCGCTGCTGCCCGCGACGGAGCGCGAGGCGCTGCGCGAGCGGGTGACGACC
GAGCTGGCGGAGCTGGGCGTGACCGCCGCCGGCCTGCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001365 Adenosine/AMP deaminase domain (Domain)
 [18-336]  3.30000000000002e-65 PF00962
PF00962   A_deaminase
IPR006330 Adenosine/adenine deaminase (Family)
 [18-338]  3.99999999999998e-79 TIGR01430
TIGR01430   Aden_deam
SignalP No significant hit
TMHMM No significant hit