close all open/close all

CDS information : Calm_00170


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction16,249 / 16,962 / + [in whole cluster]
16,249 / 16,962 / + [in contig]
Location16249..16962 [in whole cluster]
16249..16962 [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative HxlR family transcriptional regulator
Product (GenBank)CalU8
Gene
Gene (GenBank)calU8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
Q8GMD6
NITE
C1027_00570
PmId
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)
Family/Domain
FD
IPR002577

close this sectionSequence

selected fasta
>putative HxlR family transcriptional regulator [CalU8]
MKEQRDRRTYGQQCGLAFALDVVGERWTLLIIRELLVRPRRYRDLLDALPGIGTNLLADR
LAFLTEAGIIEPLDAERRTAGYALTALGEKLREPVLVLARFGLTLLAEQPARTSASVTRA
SWAVLAIESMVDPARALADEVYEFDIEGELFHVRVAAGEARTVQGTAGADATLRVATDAR
TFFDLGSGAIEPVEAVVSGAVSVTGPPAALPRCLYLLGLGGRPAGERALSAAGAGRR
selected fasta
>putative HxlR family transcriptional regulator [CalU8]
GTGAAAGAGCAACGGGACCGTCGGACGTACGGCCAGCAGTGCGGCCTGGCCTTCGCACTG
GACGTGGTGGGTGAGCGCTGGACGCTGCTCATCATCCGCGAGCTGCTGGTCCGGCCTCGC
CGCTACCGCGACCTGCTGGACGCCCTGCCGGGCATCGGCACCAACCTCCTCGCCGACCGG
CTGGCCTTCCTCACCGAGGCCGGCATCATCGAGCCGCTGGACGCCGAACGGCGCACGGCG
GGCTACGCGCTCACCGCGCTGGGCGAGAAGCTGCGGGAGCCGGTCCTGGTGCTGGCCCGG
TTCGGGCTGACGCTGCTCGCCGAGCAGCCCGCCCGCACCAGCGCCTCGGTGACCCGGGCC
TCCTGGGCCGTGCTGGCCATCGAGTCCATGGTCGACCCGGCCCGGGCCCTCGCCGACGAG
GTCTACGAGTTCGACATCGAGGGCGAGCTGTTCCACGTCCGCGTCGCCGCCGGGGAGGCC
CGCACGGTGCAGGGGACGGCCGGCGCGGACGCCACGTTGCGGGTCGCCACCGACGCCCGG
ACCTTCTTCGATCTCGGCAGCGGCGCGATCGAGCCGGTCGAGGCCGTGGTCAGCGGGGCG
GTCTCCGTCACCGGTCCGCCGGCGGCGCTCCCCCGCTGCCTCTACCTGCTCGGCCTGGGC
GGCCGGCCGGCCGGCGAGCGGGCACTCTCCGCGGCGGGCGCCGGCCGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002577 Helix-turn-helix, HxlR type (Domain)
 [22-104]  1e-13 PF01638
PF01638   HxlR
 [14-110]  PS51118
PS51118   HTH_HXLR
IPR003033 SCP2 sterol-binding domain (Domain)
 [134-207]  1.9e-05 PF02036
PF02036   SCP2
 [118-218]  6.20000124972815e-11 SSF55718
SSF55718   SCP2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-96]  3.2e-05 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit