close all open/close all

CDS information : Calm_00180


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction17,672 / 16,890 / - [in whole cluster]
17,672 / 16,890 / - [in contig]
Locationcomplement(16890..17672) [in whole cluster]
complement(16890..17672) [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalS6
Gene
Gene (GenBank)calS6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalS6]
MIVGIIGRGRMGSALARALAAHGGPVLIAGRGDPVRPPDPFAPYPGIRSVPTGAVVAGAD
LVVLMLPFAAAVELALAGRLDDGRGRTVIDATNPPQAGVAPSAPAGSGGRLLAELLPQWR
VVKALNTVPAGMLDEPVLDGRPVTVPLAGDHPPAKAEVSVLLRRLGFAPVDVGGIDRAPA
LESLADLLMAISSRHALRGRLGFQVALAEPRAAVDGGLSGPAHVELNRRAPAGGGERQRR
PAPAAESARSPAGRPPRPSR
selected fasta
>hypothetical protein [CalS6]
ATGATCGTCGGCATCATCGGGCGCGGTCGGATGGGATCGGCGCTGGCCAGGGCGCTTGCG
GCGCACGGGGGCCCGGTCCTGATCGCCGGCCGCGGGGACCCGGTGCGACCCCCCGACCCC
TTCGCCCCGTACCCCGGAATCCGGTCCGTCCCGACGGGCGCCGTCGTCGCCGGGGCGGAC
CTGGTGGTGCTGATGCTGCCGTTCGCCGCCGCCGTGGAACTGGCCCTGGCCGGCCGGCTC
GACGACGGACGGGGACGTACGGTCATCGATGCGACGAACCCGCCGCAGGCCGGTGTCGCC
CCGTCCGCTCCCGCCGGATCCGGGGGGCGGTTGCTAGCGGAACTGTTACCGCAGTGGCGC
GTCGTCAAGGCGCTCAACACCGTGCCGGCCGGCATGCTCGACGAGCCCGTCCTCGACGGG
CGCCCGGTCACCGTGCCCCTGGCCGGCGACCACCCGCCCGCCAAGGCGGAGGTGAGCGTG
TTGCTGCGCCGACTCGGATTCGCCCCGGTGGACGTCGGTGGCATCGACCGCGCGCCGGCG
CTGGAGTCGCTGGCCGACCTGTTGATGGCGATCAGCAGCCGGCACGCCCTCCGGGGGCGG
CTCGGCTTCCAGGTCGCCCTCGCGGAGCCGCGGGCCGCGGTGGACGGCGGGCTGTCCGGG
CCGGCGCACGTCGAGCTGAACCGCCGCGCGCCGGCGGGCGGCGGCGAGCGTCAGCGCCGG
CCGGCGCCCGCCGCGGAGAGTGCCCGCTCGCCGGCCGGCCGGCCGCCCAGGCCGAGCAGG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004455 NADP oxidoreductase, coenzyme F420-dependent (Family)
 [3-94]  3.60000000000001e-13 PF03807
PF03807   F420_oxidored
IPR016040 NAD(P)-binding domain (Domain)
 [1-203]  2.19999999999997e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit