close all open/close all

CDS information : Calm_00190


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction17,960 / 19,825 / + [in whole cluster]
17,960 / 19,825 / + [in contig]
Location17960..19825 [in whole cluster]
17960..19825 [in contig]
TypeCDS
Length1,866 bp (621 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)CalR2
Gene
Gene (GenBank)calR2
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional regulator [CalR2]
MNRTEIELRIQILGPVRATIRGREVDLGPPKQRAVLALLALRAGRHVPLDDLIAALWAGQ
PPTRAANLVHTYVARLRHAVEPDTPRRQRTNVIVSVPGGYRLTVADDQLDLQVFRAGVRR
ASALRDSGELESAFARYGESIDQWQDPQIGDLSALLAEQDDVGPLRQEFLAAALDYIALG
LELRRPDAVLPLAERLAQAEPLNERVQARVLQALTHIGQRAWAIERYADVRTRLKLDLGV
DPGPELAAAYREVLDARPGVHQPPWRGPAPVVDELIGRAADLSAVCDLLREYRLVSLTGA
AGVGKTALGLAAAEELRERFADGVAVADLANVRTGPDLTRAVEVAVDEPPARGAGRCEPL
VHRLHDRKLLLVLDNAELVTDEAADLADDVLRNCPQITILLTSRELLGLPYEAVYPVRPL
VVDAEPGHLAEQPALQLFARRAAQVRPGFRLTESNIDAVASVCRALDGLPLAIELAAACL
RTQRLETLVDGLDDPLRRIQPPRRGVPSHHRSLHAAVHRSIELLDPAEQRCFTALGAMPA
AFCLEAAAVADKAIAGEPRTVQMLLERLVDKSVLEVRHSSSGRRYRMLGTVHALARQLLY
EHGVDGEPPSLGCTCGCHTGR
selected fasta
>putative transcriptional regulator [CalR2]
GTGAACCGGACCGAGATCGAACTCCGAATTCAGATCCTCGGTCCCGTCCGAGCGACGATT
CGCGGCAGGGAGGTCGACCTCGGCCCCCCGAAGCAGCGGGCGGTCCTCGCCCTGCTGGCC
CTGCGGGCCGGACGACATGTGCCGCTGGACGACCTGATCGCCGCACTCTGGGCGGGACAG
CCCCCGACGAGGGCCGCCAACCTGGTCCACACCTACGTCGCGCGGTTACGCCACGCGGTC
GAGCCCGACACGCCTCGACGACAGCGCACCAACGTCATCGTGTCGGTGCCCGGCGGGTAC
CGGCTGACCGTCGCCGACGACCAGCTCGACCTGCAGGTGTTCCGCGCCGGCGTCCGGCGG
GCGTCGGCGCTGCGGGACAGCGGCGAGCTCGAGAGCGCGTTCGCCCGGTACGGCGAGAGC
ATCGACCAGTGGCAGGATCCCCAGATCGGCGACCTGTCCGCGCTGCTGGCCGAGCAGGAC
GACGTCGGCCCGCTGCGGCAGGAGTTCCTGGCCGCCGCGCTCGACTACATCGCGCTCGGC
CTCGAGCTGCGCCGGCCGGACGCGGTCCTGCCGCTGGCCGAGCGGCTGGCCCAGGCGGAG
CCGCTCAACGAGCGGGTGCAGGCCCGGGTGCTCCAGGCGCTCACGCACATCGGCCAGCGC
GCGTGGGCCATCGAACGGTACGCCGACGTGCGCACGAGGCTCAAGCTCGACCTGGGCGTG
GACCCCGGCCCCGAACTCGCGGCGGCGTACCGGGAGGTGCTGGACGCCCGGCCCGGCGTC
CACCAGCCGCCGTGGCGGGGGCCGGCACCGGTGGTGGACGAGCTGATCGGGCGGGCGGCC
GACCTGTCGGCGGTCTGTGACCTGCTGCGGGAATACCGCCTGGTGAGCCTGACCGGGGCG
GCCGGCGTCGGCAAGACCGCGCTCGGCCTGGCGGCGGCGGAGGAACTGCGAGAGCGGTTC
GCCGACGGTGTGGCGGTGGCCGACCTGGCGAACGTCCGCACCGGCCCGGACCTGACGCGG
GCGGTCGAGGTCGCCGTCGACGAGCCACCGGCCCGGGGCGCCGGCCGCTGCGAACCGCTG
GTGCACCGGCTGCACGACCGGAAGCTGCTGCTCGTGCTGGACAACGCCGAGCTGGTCACG
GACGAGGCCGCCGACCTGGCGGACGACGTGCTGCGCAACTGCCCGCAGATCACCATCCTG
CTGACCTCGCGGGAACTGCTGGGGCTGCCGTACGAGGCGGTGTACCCGGTGCGGCCGCTG
GTCGTGGACGCGGAGCCCGGTCACCTGGCCGAGCAACCCGCCCTGCAGTTGTTCGCCCGG
CGGGCGGCGCAGGTGCGGCCGGGCTTCCGGCTCACCGAGTCCAACATCGACGCGGTGGCG
TCGGTGTGCCGGGCCCTCGACGGGCTGCCGCTCGCCATCGAGCTCGCCGCGGCCTGCCTG
CGGACGCAGCGCCTCGAGACGCTGGTCGACGGCCTCGACGACCCGCTGCGCCGGATCCAG
CCGCCCCGCCGCGGCGTGCCCAGTCACCACCGCTCGCTGCACGCCGCGGTGCACCGCAGC
ATCGAGCTGCTGGATCCGGCCGAGCAACGCTGCTTCACCGCGCTCGGCGCGATGCCGGCC
GCGTTCTGTCTGGAGGCGGCGGCCGTCGCCGACAAGGCGATCGCCGGCGAGCCGCGTACG
GTGCAGATGCTGCTGGAACGGCTGGTGGACAAGTCGGTCCTGGAGGTCCGGCACAGCTCG
TCGGGCCGGCGTTACCGGATGCTGGGCACGGTGCACGCACTGGCCCGGCAGCTCCTGTAC
GAGCACGGCGTGGACGGCGAACCCCCCTCCCTCGGCTGCACCTGCGGTTGCCACACGGGC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [294-309]  4.70000326671386e-09 PR00364 [363-377]  4.70000326671386e-09 PR00364 [466-480]  4.70000326671386e-09 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [29-102]  1.6e-12 PF00486
PF00486   Trans_reg_C
 [22-102]  5.29999657550189e-16 SM00862
SM00862   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [290-540]  9.50000000000001e-08 PF00931
PF00931   NB-ARC
IPR005158 Bacterial transcriptional activator domain (Domain)
 [109-254]  4.60000044330862e-27 SM01043
SM01043   BTAD
 [109-254]  2.2e-30 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [17-103]  7.59999999999999e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [7-103]  8.29999581180007e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit